KEGG   Azoarcus sp. BH72: azo3884
Entry
azo3884           CDS       T00441                                 

Definition
(GenBank) hypothetical regulatory protein
  KO
K07169  FHA domain-containing protein
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    azo3884
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CAL96500
RhizoBase: azo3884
UniProt: A1KCE4
Position
4257210..4259045
AA seq 611 aa
MLRISVIQVNGFPPATPLAGEFDERGGTIGRDDSNALTLPDPGRHISRMQAQVQYDGSRY
VLTDHGGNPTHLNGRPLGKGASATLRDGDEIGIADYTLRVEIVRTVSGFGNETLPNIEQR
GDPLGLDLDLALPPDLPAGLGAPAAAAPPPRAAALDDDPFAVFAAATPTPPAPPAAAPPA
ASVSDDPFAAFAPARPAPPPAPASSRAGDPLGIGALAQPAEASSLDALFGLDGASTGGDP
FAGSPLGNPAHAPAPFDGGGEDPLALLGGMAATPSSAPVRNDSPLLNDAFAPPRLIDDSP
PRPLAPAPASAAAPAPQRSPAAPQGGVVSWASTPAAPAAPAAPAVPAAGDDGREAPTRIV
PAFPPPEAPRANVGIERAPLTPAPAPAPSPVPPASAPAAAAQPAAASAGSSADADALLAA
FARGIGLPRLAPAGGLTPELMEHIGRMLREAVQGTVELLVARAATKREVRADVTMIVSKN
NNPLKFSPDVDFALMQLLLPQGSGFMKPDEAMQDAYDDLRAHQLGFMAGMRAALASILGR
FTPAELEARLTTKSFLDNVLPANRKAKLWDLYEQRYGDISREAEDDFHSLFGREFLKAYE
AQIDQLQRERG
NT seq 1836 nt   +upstreamnt  +downstreamnt
gtgctacgcatcagtgtcatccaggtcaacggctttccgcccgccaccccgcttgccggc
gaattcgacgagcgcggcggcaccatcggtcgcgacgacagcaacgcgctgaccctgccc
gaccccggccgccacatctcgcgcatgcaggcccaggtccagtacgacggcagccgctat
gtgctgaccgaccacggcggcaaccccacccatctcaacggccgcccgctgggcaagggc
gccagtgccacgctgcgcgacggcgacgagatcggcatcgccgactacacgctgcgggtc
gagatcgtgcgcaccgtatccggcttcggtaacgaaacgctgcccaacatcgaacagcgc
ggcgacccgctcgggctggatctcgatctcgcgctgccgcccgatcttccggcgggcctc
ggcgccccggccgcagccgcgccgccgccgcgcgccgccgcgctcgacgacgatccgttc
gcggtgttcgccgccgccacgccgacgccgcccgcgccgcctgctgccgctccgcccgcg
gcgtcggtgtccgacgacccgttcgcggcattcgcgcccgcgcggccggccccgcccccc
gcgcccgcgtccagccgcgcgggcgatccgctcggcatcggtgcgctggcgcagcccgcc
gaagcgagttcgctcgacgcgctgttcggcctcgacggcgccagcaccggcggcgacccc
ttcgccggctcgccgctcggcaacccggcccatgcgcccgccccgttcgacgggggcggc
gaagacccgctggcgctgctcggcggcatggcggcaacgcccagcagcgccccggtgcgc
aacgattcgccgctgctcaacgacgccttcgccccgccgcgcctgatcgacgacagccca
ccgcggccgcttgcccccgccccagcgtccgccgccgcaccggcaccgcagcgcagcccc
gctgcgccgcaaggcggcgtggtgtcgtgggccagcacgcccgccgcccccgccgcaccg
gcagcgccggcagtgccggccgccggggacgacggacgcgaggcgccgacccgcatcgtg
cccgcattccccccgccggaggccccgcgcgccaacgtcggcatcgaacgcgcgccgctg
acgcccgccccggcgccggcgccctcccccgtgccgccggcgtctgcaccagccgccgcg
gcgcaacccgcggccgccagcgccggctccagtgccgacgccgacgcgctgctggccgcc
tttgcccgcggcatcggcctgccgcggctggccccggcgggcgggctgacccccgaactg
atggagcacatcggccgcatgctgcgcgaggcggtgcagggcacggtggaactgctggtc
gcgcgcgcggccaccaagcgcgaggtgcgcgcggacgtgaccatgatcgtcagcaagaac
aacaacccgctgaagttctcgcccgacgtcgatttcgcgctgatgcagctgctgctgccg
cagggcagcggcttcatgaagccggacgaggcgatgcaggacgcctacgacgatctgcgc
gcccatcagctcggcttcatggccggcatgcgtgcggcgctggcgagcatcctcggccgc
ttcaccccggccgagctggaagcccgcctgaccaccaagagcttcctcgacaacgtgctg
ccggccaaccgcaaggccaagctgtgggacctctacgagcaacgctatggcgacatctcg
cgcgaggccgaggacgacttccattcgctgttcgggcgcgagttcctgaaggcctacgag
gcccagatcgaccagttgcagcgcgaacgcggctga

DBGET integrated database retrieval system