KEGG   Azoarcus sp. BH72: azo3890
Entry
azo3890           CDS       T00441                                 

Gene name
imcF
Definition
(GenBank) conserved hypothetical ImcF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
azo  Azoarcus sp. BH72
Pathway
azo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    azo3890 (imcF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo3890 (imcF)
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo3890 (imcF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: CAL96506
RhizoBase: azo3890
UniProt: A1KCF0
Position
complement(4264709..4268281)
AA seq 1190 aa
MKAVFKFLFHPVLLGILGLIALALVIWFVGPLIAVAGWAPLESALARLILIGLVVAFVVF
RLVWRKIKAKKQNAQLVEGLVKADDAGADKAATPDEVETLRKRFEEALRVLKDSQAAAHA
RQGGVARLLSAGSGRYLYELPWYVFIGAPGSGKTTALINSGLHFPLAEKLGIHQLKGVGG
TRNCDWWFTDDAVLIDTAGRYTTQDSDQASDRGAWQGFLGLLKRHRPRQPLNGVLLTVSL
GDLLAQDADGAERHAAALRARVQELYEQLNVRLPIYVLVTKADLIAGFNEFFNDFGKEAR
DQVWGVTFPQQGDSAAALQALPGELGRLRERVLDLLPVRLRDERDLARRGAIAAFDQQLA
AANRLLGAFLGKVFAPSGFDHALMLRGVYFTSGTQEGSPIDRVMSSLGSAFGLERRVIPP
QSGSGKSFFITRLLREVVFAEQRIGGTNLKWERRRGLVRLATFAGIGVLTVGLALAWALS
YHNNDAYIDAVGERVKTVQPVVADARVAASDDVVGILPVLDAVRTVSHTDLRPQGEAPLS
MRFGLYQGDKLDAAAEQAYRGMLRDVLLPRIAMRVEKQLRNLDPNNLEFAYEALKSYIML
HDATHFDAESIKAWISLDWELNLPRDTTAEQRAALAGYLDALFKDGAVVSPVAADAELIA
RVRNQLLRYTLPDRIYSRLKRQGVGSEFPEFTVEKAVGPSASLVFVRKSGQPLTRGVPGL
YSFDGYHKGFDPQVERVSAHLAEEEPWVLGTASAKPDAAGAKQVADEVRRLYLTDYARVW
EAYIDDIAVQRAGSLQQSIQVARVLSAADSPLPKLMKAMSRETTLIVATEDKSVIDKAQQ
RVAEARSELGRMIFGANQPGQGAAAGAGIERIVDDRFVALRQLVTGDGNTAPINAVVTLL
NDVYVNLSATETALRDKVAPPPSDATARVKAESARMPEPVRSMLQQLSAAGTGQALSSLR
ESLSTAVATQVGQFCGQATDGRYPFVRSSARDVTRDDFAALFGPGGKFDSFFNQQLAQYV
DVGTSPWSFRKVQEQSLGAPGNLVQFQRASVIRDVFFRSGGNLRLDFKPIEMDPAITHFT
LDVDGQLVNYAHGPQVPQSVQWPGPKGGLQVRVQITPPGQSGTSGIATDGPWALFRMLDK
ANITPTSLPEKFRATFVVDGRSAVFEVTTNSVQNPFRLRELVDFRCPSGL
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgaaagccgtcttcaagttcctcttccacccggtgctgctcggcatcctcgggctgatc
gcgctggcgctggtgatctggttcgtcggtccgctgatcgcggtcgccggctgggcgccg
ctggagtccgcgctggcgcggctgatcctgatcgggctggtggtcgccttcgtggtgttc
cgcctcgtgtggcgcaagatcaaggcgaagaagcagaacgcccagctcgtcgaaggtctg
gtcaaggccgacgacgccggcgccgacaaggccgccacgcccgatgaggtcgaaaccctg
cgcaagcgcttcgaggaagcgctgcgggtgttgaaggacagccaggccgcggcgcacgcc
aggcagggcggcgttgcccgcctgctgtcggccgggtccggccgctatttgtacgagctg
ccgtggtacgtcttcatcggcgcgccgggctcgggcaagaccaccgcgctgatcaactcc
ggcctgcacttcccgctcgccgagaaactcggcatccaccagttgaagggtgtcggcggc
acgcgcaactgcgactggtggttcaccgacgacgcggtgctgatcgacaccgccggccgc
tacaccacccaggattccgaccaggccagcgaccgcggcgcctggcagggcttcctcggc
ctgctgaagcgccatcgcccgcgccagccgctcaacggtgtgctgctcaccgtcagcctc
ggcgacctgctggcgcaggatgccgacggcgccgaacgccatgccgccgcgctgcgcgcc
cgcgtgcaggagctgtacgagcagctcaacgtccgcctgccgatctacgtgctggtcacc
aaggccgacctgatcgccggcttcaacgaattcttcaacgatttcggcaaggaagcgcgc
gaccaggtgtggggcgtcaccttcccgcagcagggcgattccgccgccgcgctgcaggcg
ctgccgggcgaactcgggcgcctgcgcgagcgtgtgctcgacctgctgccggtgcgcctg
cgcgacgagcgcgaccttgcgcggcgcggcgcgatcgccgccttcgaccagcagctcgcg
gccgccaaccgcctgctcggcgccttcctcggcaaggtgttcgccccgtccggtttcgac
cacgcgctgatgctacgcggggtgtatttcaccagcggcacgcaggaaggcagcccgatc
gaccgcgtgatgtcctcgctcggttccgccttcggcctcgaacgccgcgtgattccgccg
caaagcggcagcggcaagagcttcttcatcacccgcctgctgcgcgaagtggtgtttgcc
gagcagcgcatcggcggcaccaacctgaagtgggaacgccgccgcggtctggtgaggctg
gcgacgtttgccggcatcggcgtgctcaccgtcgggctcgcgctcgcctgggccttgagc
tatcacaacaacgacgcctacatcgacgccgtcggcgagcgcgtgaagacggtgcagccg
gtcgtcgccgacgcccgcgtggccgcctccgacgatgtggtcggcatcctgccggtgctc
gacgcggtgcgcaccgtgtcgcacaccgacctgcggccgcagggcgaggcgccgctgtcg
atgcgcttcggcctgtaccagggtgacaagctcgacgctgccgccgagcaggcctatcgc
ggcatgctgcgcgacgtgctgttgccgcggatcgcgatgcgggtcgaaaagcagctgcgc
aacctcgaccccaacaatctcgagttcgcctacgaggcgctgaagagctacatcatgctg
cacgatgcgacgcacttcgatgccgagtcgatcaaggcctggatcagcctcgactgggaa
ctcaacctgccgcgcgacaccaccgccgagcagcgtgcggcgctcgccggctacctcgac
gccttgttcaaggacggcgcggtggtgtcgccggtggcggcggatgcggagctgatcgcg
cgggtgcgcaaccagctgctgcgctacaccctgccggaccgcatctacagccgcctcaag
cgccagggcgtgggcagcgaattccccgaattcaccgtcgaaaaggcggtcggcccgtcg
gcctcgctggtgttcgtgcgcaagagcggccagccgctgacccgcggcgtgcccggcctg
tacagcttcgacggctaccacaagggcttcgacccgcaggtcgagcgcgtctccgcccac
ctcgccgaggaagaaccttgggtgctcggcaccgcctcggccaagccggacgccgccggc
gccaagcaggtggcggacgaagtgcgccggctctacctgaccgactacgcccgcgtgtgg
gaagcctacatcgacgacatcgcggtgcagcgcgccggcagcctgcagcagagcatccag
gtggcgcgggtgctgtcggcggcggattcgccgctgcccaagctgatgaaagcgatgtcg
cgcgagaccacgctgatcgtcgctaccgaggacaagtcggtgatcgacaaggcccagcag
cgcgtggcggaagcccgcagcgaactcggccgcatgatcttcggcgccaatcagcccggc
cagggcgcagccgccggtgccggcatcgagcgcatcgtggacgaccgcttcgtggcgctg
cgccagctcgtcaccggcgacggcaacaccgcgccgatcaatgcggtggtgacgctgctc
aacgatgtgtacgtcaatctgtcggccaccgaaaccgcgctgcgcgacaaggtggcgccg
ccgccgtcggatgccaccgcgcgcgtcaaggcggaaagcgcgcgcatgcccgagccggtg
cgctcgatgctgcagcagctctccgccgccggcaccggtcaggcgctgagttcgctgcgc
gaatcgctgtccaccgcggtggccacccaggtcggccagttctgcggtcaggccaccgac
ggccgctatcccttcgtgcgcagcagcgcgcgcgatgtcacccgcgacgatttcgccgcg
ctgttcggccccggcggcaagttcgacagcttcttcaaccagcagctggcgcagtatgtg
gatgtcggcacctcgccgtggagcttccgcaaggtgcaggaacagtcgcttggcgcccct
ggcaatctggtgcagttccagcgcgcctcggtgatccgcgacgtgttcttccgcagcggc
ggcaacctgcggctggacttcaagcccatcgagatggaccccgcgatcacccacttcacg
ctcgatgtagacggtcagctggtgaactacgcgcatggtccgcaggtgccgcagtcggtg
cagtggcccggccccaagggcggcctgcaggtgcgggtgcagatcacgccgccgggccag
agcggcacctccggcatcgccaccgacggcccctgggcgctgttccgcatgctcgacaag
gccaacatcacgccgacttcgctgccggagaagttccgcgccaccttcgtggtggatggc
cgctcggcggtgttcgaagtgaccaccaacagcgtgcagaaccccttccgcctgcgcgag
ctggtggatttccgctgcccgtccgggctgtga

DBGET integrated database retrieval system