KEGG   Azoarcus sp. BH72: azo3891
Entry
azo3891           CDS       T00441                                 

Gene name
ompA2
Definition
(GenBank) putative outer membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
azo  Azoarcus sp. BH72
Pathway
azo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    azo3891 (ompA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo3891 (ompA2)
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo3891 (ompA2)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAL96507
RhizoBase: azo3891
UniProt: A1KCF1
Position
complement(4268313..4269617)
AA seq 434 aa
MNQDDPFGQPPGDRTLVIPNPGARAARPAAAAAPAQGFSFGRVELSALDWSAGLNPLVAA
ANPLLNLVPQLRQAHHPDPAGLRETLARAVQAFETKAREVGVLNEHVVGARYALCTFLDE
TAANTPWGEKIWAQKSLLVQFHNEAWGGEKFFQLLGKVAEQPGTHRNLLELFYIILALGF
EGRYRVLQNGRAQLDAVRERLAQMILKERGEPVRELSPQWQTTATSARPLRDSVPIWAVA
AIAALLLVLIYLAASYALNRHSDPAFAQILGLKVPPPAPLAQAAAVPAKVPDRLQGFLAP
EIREGLVTVRDLPDRSVVQIQGDGLFEPASATLAPRVLPLMARIGEAVARVKGSVLVRGH
SDDRPIRSARFPSNWHLSQARADSVAAVLAPQLGGARIETEGRAESEPVASNDTPEGRAR
NRRVEIIVFPAAGD
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaaccaagacgatcctttcggccagccacccggcgaccgtacgctggtgattcccaac
ccgggagcgcgcgccgcgcgcccggcggcggccgcggcgccggcgcagggcttcagcttc
gggcgggttgagctgtccgcgctcgactggagcgccggcctcaatccgctggtcgccgcc
gccaatcccttgctcaacctggtgccgcagctgcgtcaggcccatcaccccgatcccgcc
gggctgcgcgaaacgctcgcgcgcgcggtgcaggccttcgaaaccaaggcgcgcgaggtc
ggcgtgctcaacgagcatgtcgtcggcgcccgctacgcgctgtgcaccttcctcgacgag
accgccgccaacacgccgtggggcgagaagatctgggcgcagaagagcctgctggtgcag
ttccacaacgaagcctggggcggcgagaagttcttccagctgctgggcaaggtcgccgag
cagcccggcacccaccgcaacctgctcgaactcttctacatcatcctggcgctcggcttc
gagggccgctatcgcgtgctgcagaacggccgcgcccagctcgacgcggtgcgcgaacgg
ctggcgcagatgatcctcaaggagcgcggcgagccggtgcgcgaactgtcacctcagtgg
cagaccaccgcgaccagcgcgcgcccgctgcgcgactcggtgccgatctgggcggtcgcg
gcgattgccgcgctgctgctggtgctgatctatctggccgcgtcctacgcgctcaaccgc
cactccgaccccgctttcgcgcagatcctcggcctcaaggtgccgccgccggcgccgctg
gcacaggccgccgcggtgccggcgaaggtgcccgaccggttgcagggcttcctcgccccc
gaaatccgcgaagggctggtgaccgtgcgcgacctgccggaccgcagcgtggtgcagatc
cagggcgacggcctgttcgaaccggccagcgccacgctggcgccgcgcgtgctgccgctg
atggcgcgcatcggcgaggcggtggcgcgggtcaagggttcggtgctggtgcgcggccat
tccgacgaccgtccgatccgctccgcgcgcttcccgtccaactggcatctgtcgcaggcc
cgcgccgattcggtggcggcggtgctggcgccgcagctcggcggcgcgcgcatcgagacc
gagggccgcgccgagagcgagccggttgcctccaacgacaccccggaagggcgcgcgcgc
aaccgccgcgtcgagatcatcgtgttcccggccgcgggcgactga

DBGET integrated database retrieval system