KEGG   Azoarcus sp. BH72: azo3900
Entry
azo3900           CDS       T00441                                 

Gene name
sciD
Definition
(GenBank) putative cytoplasmic protein, sciD
  KO
K11897  type VI secretion system protein ImpF
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo3900 (sciD)
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo3900 (sciD)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CAL96516
RhizoBase: azo3900
UniProt: A1KCG0
Position
4277167..4277676
AA seq 169 aa
MADLLPLDRLQPALLDRLRDDAPDQRHEAKEARVLGRSQLREAVLRDLTWLLNAMRPPER
EGVGVWPEVENSVLNYGMPCFSGETASSLDITDLERAIRDSLLRFEPRIIPGTLEVSTEQ
HENILDWHNVISVRISAQIWAQPVPLELLLRTQLDLESGLVEVRDINGY
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgacctgctgccgctcgaccgcctgcagccggcgctgctcgaccgcctgcgcgac
gacgcgccggaccagcgccacgaggccaaggaagcgcgcgtgctcggccgcagccagctg
cgcgaggcggtgctgcgcgacctcacctggctgctcaacgcgatgcgcccgccggagcgg
gagggcgtcggggtgtggccggaggtcgagaactcggtgctgaactacggcatgccgtgc
ttttccggggaaaccgcgtcctcgctcgacatcaccgacctcgaacgcgcaatccgcgac
tcgctgctgcgtttcgagccgcgcatcatccccggcacgctcgaggtcagcaccgagcag
cacgagaacatcctcgactggcacaacgtgatcagcgtgcgcatctcggcgcagatctgg
gcgcagccggtgccgctcgaactgctgctgcgcacccagctcgacctcgaaagcggcctg
gtcgaggtgcgcgacatcaacggctactga

DBGET integrated database retrieval system