KEGG   Azoarcus sp. DD4: CJ010_06090Help
Entry
CJ010_06090       CDS       T06048                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
azr  Azoarcus sp. DD4
Brite
KEGG Orthology (KO) [BR:azr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:azr03009]
    CJ010_06090
Enzymes [BR:azr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CJ010_06090
Ribosome biogenesis [BR:azr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CJ010_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: QDF96142
UniProt: A0A4Y6KQ68
Position
complement(1296785..1297879)
Genome map
AA seq 364 aa AA seqDB search
MSSHSAASSFSVSGLLAYCRAGFEKELASELDDLAADAGLIGYVRTEPGSGYAAFETFEP
VPVIALGERADWRKPVFARQLLPWFDRIEDLPERDRATPLVDLVRGSGQRFSGVVLETPD
TDEAKQRSGFCRRFTEPLTRELEKAGALRLGKPGLPELHVMFPDATSAWLATGMKGRCAP
WPMGIPRLRMPSSAPSRSTLKLAEAFMTLLSEEERDTLLRAGMRAVDLGAAPGGWTWQLA
QRGMRVTAIDNGPLRDTVMATEMVEHLKADGFTWRPQRPVDWMVCDMVEQPSRIASLMAE
WVATGRCRHTIFNLKLPMKRRLDAVEQCRELIRKRLASVGPFDLRIKQLYHDREEVTAYL
TLKK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccactccgccgcatccagtttttccgtctccggcctgctcgcttactgccgc
gcggggttcgaaaaggaactcgcctccgagctcgacgatcttgcggccgacgccggcctg
atcggctatgtccgtaccgagccgggcagcggctacgccgccttcgaaaccttcgaaccc
gtaccggtgattgcgctgggcgagcgcgctgactggcgcaagcccgtcttcgcccgccag
ctgctaccctggttcgaccgcatcgaagaccttcccgaacgcgatcgcgccacgccgctg
gtcgacttggtcaggggctccggccagcgcttttccggcgtcgtgctcgaaaccccggac
accgacgaggccaagcagcgctcgggcttctgccgccgtttcaccgaaccgctcacccgc
gaactggaaaaggccggtgcgctgcgcctgggcaaacccggtttgccggaactccacgtc
atgttccctgacgcgaccagcgcctggctcgccaccggcatgaagggccgttgcgcgccg
tggccaatgggcattccccgcctgcgcatgccgtccagcgctcccagccgttccaccctc
aagctcgccgaagccttcatgaccctgctgagcgaggaggaacgcgacacgctgctgcgt
gctggcatgcgtgcggtcgacctcggtgcggcccccggcggctggacctggcagcttgcg
cagcgcggcatgcgcgtcaccgccatcgacaacggcccgctgcgcgataccgtgatggcc
accgagatggtcgagcacctcaaggccgacggcttcacctggcgaccgcagcggccggtg
gactggatggtctgcgacatggtcgagcaacccagccgcatcgcctcgctgatggccgag
tgggttgccaccggccgctgccgccacaccatcttcaacctcaagctgccaatgaagcgc
cggctcgatgccgtcgagcagtgccgcgaactgatccgcaagcggcttgccagcgtcggc
cccttcgatctgcgcatcaagcagctgtaccacgatcgcgaggaagtgaccgcctacctg
acgctgaagaagtaa

DBGET integrated database retrieval system