KEGG   Azoarcus sp. DD4: CJ010_19730Help
Entry
CJ010_19730       CDS       T06048                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
azr  Azoarcus sp. DD4
Pathway
azr00450  Selenocompound metabolism
azr00970  Aminoacyl-tRNA biosynthesis
azr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CJ010_19730
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CJ010_19730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:azr01007]
    CJ010_19730
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:azr03016]
    CJ010_19730
Enzymes [BR:azr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CJ010_19730
Amino acid related enzymes [BR:azr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CJ010_19730
Transfer RNA biogenesis [BR:azr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CJ010_19730
 Prokaryotic type
   Other AARSs
    CJ010_19730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: QDF98605
UniProt: A0A4Y6L075
Position
4285359..4287542
Genome map
AA seq 727 aa AA seqDB search
MPRKILVTNALPYANGDIHLGHLVGYIQGDIWVRYQRMRGNSVHYVCADDTHGTPIMLRA
EKEGITPEQLINRVHGEHLRDFTDFGVGFDNYHSTHSAENRAYAEDIYGKLLSAGFIETR
SIEQFYDPVKEMFLPDRFIKGECPKCGAGDQYGDNCEVCGAAYAPTELKNPYSAVSGAKP
VLKTSEHYFFRLSDARAVEFLREWTRGTNTTGERRLQAEAANKMKEWLGEAGENKLSDWD
ISRDAPYFGFEIPGAPGKYFYVWLDAPIGYFASFRNYAERRSAAGEQIAVEDYTDTIRAE
AQGTELVHFIGKDILYFHALFWPAMLKFAGYRTPSQLCVNGFLTVDGAKMSKSRGTFITA
RSYVEQGLNPEWLRYYFASKSNGTMEDVDLNLDDMIAKVNSDLVGKYVNIASRCAGFIAK
RFGGKLGGVDPKATAEFESAYEAATIAQAYEERDYGRALREIMRLADLANQYVNDHKPWE
LAKQDGQDAQLHVVCSTALTLFRDLTLYLKPVLPALAAKVEAFLAIAPLDWQAGWKPLPA
GHDITAYQHLMTRIERKQVDALLEANRDSLAPAAAAAPAATAKTAKEASSQQRHAEKQQH
AAQAAETASPHISIDDFTKVDLRIAKIVDAQHVEGADKLIRLQLDIGETDDAGNPKPRQV
FAGIKSAYDPASLVGRLTVMVANLAPRKMKFGMSEGMVLAASDPDGKTGGLYILSPDGGA
QPGMRVK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcaagatactcgtcaccaacgccctgccctacgccaacggcgacatccacctc
ggccacctcgtcggttacatccagggcgacatctgggtgcgctaccagcgcatgcgtggc
aactcggtgcactacgtctgcgcggacgacacgcacggcacgcccatcatgctgcgcgcc
gagaaggaaggcatcacgccggaacagctgatcaaccgggtgcatggcgagcacctgcgc
gacttcaccgacttcggcgtcggtttcgacaactaccattcgacccacagcgcggaaaac
cgtgcctacgccgaggacatctacggcaagctgctgtcggccggcttcattgaaacgcgc
tcgatcgaacagttctacgacccggtcaaggaaatgttcctgccggaccgcttcatcaag
ggcgaatgccccaagtgcggcgccggcgaccaatacggcgacaattgcgaggtgtgcggc
gccgcctatgcccccaccgagctcaagaacccctactccgcggtatctggcgccaagccg
gtgctgaagacctccgagcactacttcttccgcttatccgacgctcgcgcagtcgagttc
ctgcgcgaatggacacgcggcaccaacacaaccggcgagcgccgcctgcaggcggaggcc
gccaacaagatgaaggaatggctgggcgaagccggtgagaacaagctgtccgactgggac
atctcgcgcgatgccccctacttcggcttcgagatcccgggcgcgccgggcaagtacttc
tatgtctggctggacgcgcccatcggctatttcgccagcttccgcaactacgccgagcgc
cgcagcgctgccggggaacagatcgccgtcgaggactacaccgataccatccgcgccgaa
gcccagggcaccgagctggtgcacttcatcggcaaggacatcctctacttccacgcgctg
ttctggccggcgatgctcaagtttgccggctaccgcacgcccagccagctctgtgtgaac
ggtttcctgaccgtcgacggcgccaagatgtccaagagccgcggcaccttcatcaccgcg
cgctcctacgtcgagcagggactcaacccggagtggctacgctactacttcgccagcaag
tccaacggcaccatggaagacgtcgacctcaacctcgacgacatgatcgccaaggtcaat
tccgatctggtcggcaagtatgtaaacatcgccagccgctgcgccggcttcatcgccaag
cgtttcggcggcaagctgggcggcgtcgaccccaaggccacggcggaattcgaatcggcc
tacgaggcggccaccatcgcccaggcttacgaggagcgcgactacggccgcgcgctgcgc
gagatcatgcgactggccgatctcgccaaccagtatgtgaacgaccacaaaccgtgggag
ctggccaagcaggacggtcaggacgcgcaactgcacgtcgtctgcagcacggcgctgacg
ctgttccgcgatctcacgctctacctcaagccggtgctgccggcactcgccgccaaggtc
gaggcattcctcgcgatcgccccgctcgactggcaggccggctggaagccgctgcccgcc
ggccacgacatcaccgcctaccagcacctgatgactcgcatcgagcgcaagcaggtcgat
gcgctgctcgaagccaaccgcgattcgctcgcaccggccgcagccgcggcacccgccgcg
accgccaagaccgccaaggaagcgagctcgcagcaacgccacgcggaaaagcagcagcat
gccgcgcaggcggccgagacggcatcgccgcacatctccatcgacgacttcaccaaggtc
gacctgcgcatcgcgaagatcgtcgacgcccagcatgtcgagggtgccgacaagctgatc
cgcctgcaactcgacatcggagaaaccgacgacgccggcaaccccaagccccgtcaggtc
ttcgccggcatcaagtcggcctacgacccggccagcctggtcggccgcctcaccgtgatg
gtggccaacctcgctccgcgcaagatgaagttcggcatgagcgaaggcatggtgctcgcc
gcctccgaccccgacggcaagaccggcgggctctacatcctgtcgcccgacggcggcgcc
cagccgggcatgcgcgtgaagtag

DBGET integrated database retrieval system