KEGG   Azoarcus sp. DD4: CJ010_20370Help
Entry
CJ010_20370       CDS       T06048                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
azr  Azoarcus sp. DD4
Pathway
azr00020  Citrate cycle (TCA cycle)
azr00640  Propanoate metabolism
azr00660  C5-Branched dibasic acid metabolism
azr01100  Metabolic pathways
azr01110  Biosynthesis of secondary metabolites
azr01120  Microbial metabolism in diverse environments
azr01130  Biosynthesis of antibiotics
azr01200  Carbon metabolism
Module
azr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJ010_20370
   00640 Propanoate metabolism
    CJ010_20370
   00660 C5-Branched dibasic acid metabolism
    CJ010_20370
Enzymes [BR:azr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJ010_20370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: QDF98723
Position
complement(4430878..4431771)
Genome map
AA seq 297 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTEKCQEYANGKNCFVAGVNPKKAGEKIFDIPIYASV
KEAAAETGATVSVIYVPPAGAADAIWEAVEADLDLAICITEGIPVRDMLMVRNKMKAKEA
AGGKKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTELGLG
QSSAVGIGGDPINGLKHIDVMQMFNDDPDTDAVIMIGEIGGPDEAEAAQWCKANMKKPIV
GFIAGVTAPAGKRMGHAGALISGGADTADAKLAIMEECGFKVTRNPSEMAKLLKAML
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcctgatcaacaaagacaccaaggtcatcacccagggcatcaccgggaagacc
ggtcagttccacaccgagaagtgccaggaatacgccaacggcaagaactgcttcgttgcc
ggcgtgaacccgaagaaggctggcgaaaagattttcgacatccccatctacgcctcggtg
aaggaagccgccgccgaaaccggcgccaccgtctccgtcatctacgttccgcccgccggc
gctgccgacgccatctgggaagcggtcgaagccgaccttgacctggcgatctgcatcacc
gaaggcatccccgtccgcgacatgctgatggtgcgcaacaagatgaaggccaaggaagcc
gccggcggcaagaagaccctgctgctggggccgaactgcccgggcctgatcacgcctgac
gagatcaagatcggcatcatgccgggtcacatccaccgcaagggtcgtatcggcgttgtg
tcgcgctccggcaccctgacctacgaagccgtggcgcagctcaccgagctgggtctgggc
cagtcctcggcggtcggtatcggtggcgatccgatcaacggtctgaagcacatcgacgtc
atgcagatgttcaacgacgatccggacaccgatgcggtgatcatgatcggcgagatcggc
ggtccggacgaagccgaagcggcgcagtggtgcaaggccaacatgaagaagccgatcgtc
ggtttcatcgccggcgtcaccgcgccggccggcaagcgcatgggccacgccggtgcgctg
atttccggtggcgccgacaccgccgatgccaagctcgccatcatggaagagtgcggcttc
aaggtgacgcgcaacccgtcggaaatggccaagctgctgaaggcgatgctgtaa

DBGET integrated database retrieval system