KEGG   Azospirillum sp. TSH58: TSH58p_02945Help
Entry
TSH58p_02945      CDS       T05449                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00970  Aminoacyl-tRNA biosynthesis
azt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TSH58p_02945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azt03029]
    TSH58p_02945
Enzymes [BR:azt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TSH58p_02945
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TSH58p_02945
Mitochondrial biogenesis [BR:azt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TSH58p_02945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWJ82490
UniProt: A0A2S1XDN5
Position
TSH58_p03:complement(736793..738193)
Genome map
AA seq 466 aa AA seqDB search
MRLMSARRIAEQVAARAVSAVALYDELLERIAAENPRLNAIVHLDPEAGRAEARAADERA
ARGEALPLLGVPFTVKDNIWVRGQPVRQGSRLFQDFVAPEDAVAVARLRAAGAVFAGITN
CSEFACKGVTTNLLHGPTRNPWDRSLTPGGSSGGAASAVAAGLAPLALCTDGGGSTRRPA
AHAGVVGMKPSAGIVPHPVGFAEPVFGNSVIGQMARSVADVALMLDALAGPDPRDPQSVA
VSGSFARAAADPGPAGLRIAYSRRLGLDAPVDPEVAACVERAVHRLADAGAIVEEADPVW
PEGAGESGLMPLQFAGLAALYGERYRTAPELFDPDIGQQIETGLRTGGAEVARALHLREE
AYRALAALFARYDLLVCPTTPVTAWPFDRLGPATIDGRPVTPRGHAIFTPLFNHCYAPAC
SVPCGLTESGGLPVGLQIAGPRLSDAAVLRLAAAVEATCGYTPPLP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgatgagcgcccgccgcatcgccgaacaggtcgccgcccgcgcggtcagcgcc
gtcgccctctacgacgagttgctggagcggatcgcggcggagaacccgcggctgaacgcc
atcgtccatctcgacccggaggccgggcgggcggaggcgcgggccgccgacgaacgcgcc
gcgcggggcgaggcgctgcccctgctgggcgtgcccttcacggtgaaggacaacatctgg
gtgcgcggccagccggtccgccagggatcgcggctgtttcaggatttcgtggcgccggag
gacgcggtggcggtggcccggctgcgcgccgcgggcgccgtcttcgcgggaatcaccaac
tgctcggaattcgcctgcaagggggtgacgaccaacctcctgcatggcccgacccgcaat
ccctgggaccggtcgctgacgcccggcggctcctccggcggggcggccagcgcggtggcg
gccggcttggcgccgctggcgctgtgcaccgacggcggcggctccacccgccggcccgcc
gcccatgccggggtggtcggcatgaagccgtcggccggaatcgtcccccaccccgtcggc
ttcgccgagccggtgttcggcaactcggtgatcggccagatggcccgctcggtcgccgac
gtggcgctgatgctcgacgcgctggccgggccggacccgcgcgatccgcagtcggtggcg
gtgtccggctccttcgcccgcgccgccgccgaccccgggccggcgggcctgcgcatcgcc
tacagccggcggctggggctggacgccccggtcgatccggaggtcgccgcctgcgtggag
cgcgccgtccaccgcctcgccgacgccggggccatcgtggaggaggccgacccggtctgg
cccgagggagccggggaaagcggcctgatgcccctccagttcgccggcctcgccgcgctc
tacggcgagcgctaccgcacggcgccggagctgttcgacccggacatcgggcagcagatc
gagaccggcctgcgcaccggcggcgcggaggtcgcccgcgccctgcatctgcgggaggag
gcctaccgcgcgctggccgccctcttcgcacgctacgacctgctggtctgcccgacgact
ccggtcaccgcatggccgttcgaccggctcggccccgccaccatcgatgggcgtccggtg
acgccgcgcggccacgccatcttcacgccgctgttcaatcactgctacgcgccggcctgc
tcggtcccctgcgggctgacggagagcggcgggcttcccgtggggctccagatcgccggt
ccgcggctgtccgatgcggcggttctgcggctggccgccgcggtggaggccacctgcggt
tacacgccacccttgccgtaa

DBGET integrated database retrieval system