KEGG   Azospirillum sp. TSH58: TSH58p_08395Help
Entry
TSH58p_08395      CDS       T05449                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00430  Taurine and hypotaurine metabolism
azt00620  Pyruvate metabolism
azt00640  Propanoate metabolism
azt00680  Methane metabolism
azt01100  Metabolic pathways
azt01120  Microbial metabolism in diverse environments
azt01200  Carbon metabolism
Module
azt_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSH58p_08395
   00640 Propanoate metabolism
    TSH58p_08395
  09102 Energy metabolism
   00680 Methane metabolism
    TSH58p_08395
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    TSH58p_08395
Enzymes [BR:azt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     TSH58p_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AWJ83544
UniProt: A0A2S1XGI1
Position
complement(1050000..1051172)
Genome map
AA seq 390 aa AA seqDB search
MTETILVINAGSSSIKFQLFDAADGTLPVRLRGQIEGIGTTPRLLVQGGSVPLPAESGDG
VPGALAFLGAWLRQRLGGAMPVAVGHRVVHGGPAYDTHVAVDDAVIGTLERYVPLAPLHQ
PNNLAPIRAIRKLTPEMLQVACFDTAFHRHHSELADRYAIPDALFREGVRRYGFHGLSYE
YIAGRLPDLAPGIAGGRVVVAHLGSGASMCAIRDGRSVDSTMGFTALDGLPMGTRPGQLD
PGVVLYLLDKGMDARAIERLLYHDCGLKGLSGISNDVRDLLASADPRARLALDCFVYRAS
LAIGALAAAMGGIDGLVFTAGIGERAPAIRKAIAERARWLGLDLDEAANDANALCITTPD
SRVKGCVIPTDEERMIAHHTRDILRRHRPA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacgatcctggtcatcaacgccggctcctccagcatcaagttccagctgttc
gatgcggcggacgggacgctgccggtgcgcctgcgcggccagatcgaggggatcggcacg
acgccccggctgctcgtccagggcggcagcgttccattaccggccgaatccggcgacggg
gttcccggcgcgctggcctttctcggcgcgtggctgcggcagcggctgggcggcgccatg
ccggtggcggtcgggcatcgggtggttcacggcggaccggcctacgacacccatgtggcg
gtggacgacgcggtgatcgggacgctggaacgctatgtcccgctcgccccgctccaccag
ccgaacaatctggcgccgatccgggcgatccggaagctcacgccggagatgcttcaggtg
gcctgcttcgacacggcctttcaccggcaccattccgaactggccgaccgctacgccatc
ccggacgccctcttccgggaaggtgtgcggcgctacggctttcacggcctgagctacgaa
tacatcgccgggcgcctgccggacctcgctcccgggatcgccggcgggcgggtcgtcgtc
gcgcatctcggcagcggggccagcatgtgcgccatccgggacgggcgcagcgtggacagc
accatgggcttcaccgcgctggacgggttgccgatggggacccggccggggcagctggac
cccggcgtggtcctgtatctgttggacaagggcatggacgcccgcgccatcgaacggctg
ctttaccatgactgcggcctgaagggcctgtccggcatcagcaacgacgtccgcgacctg
ctggccagcgccgacccgcgcgccaggctcgcgctggattgcttcgtctaccgggcgagc
ctcgccatcggggcgctggccgccgccatggggggcatcgacgggctcgtgttcacggcc
ggcatcggcgaacgggcgccggccatccgcaaggccatcgcggagcgggcgcgctggctc
ggcctcgacctcgacgaggcggccaacgatgcgaacgcgctgtgcatcacgacgccggac
agccgggtcaagggctgtgtcatcccgaccgacgaggagcggatgatcgcgcatcacacc
cgcgacatcctccgccgccaccgccctgcgtga

DBGET integrated database retrieval system