KEGG   Azospirillum sp. TSH58: TSH58p_15625Help
Entry
TSH58p_15625      CDS       T05449                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00020  Citrate cycle (TCA cycle)
azt00480  Glutathione metabolism
azt01100  Metabolic pathways
azt01110  Biosynthesis of secondary metabolites
azt01120  Microbial metabolism in diverse environments
azt01130  Biosynthesis of antibiotics
azt01200  Carbon metabolism
azt01210  2-Oxocarboxylic acid metabolism
azt01230  Biosynthesis of amino acids
Module
azt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TSH58p_15625
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TSH58p_15625
Enzymes [BR:azt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TSH58p_15625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AWJ84828
UniProt: A0A2S1XKU0
Position
complement(2579270..2580493)
Genome map
AA seq 407 aa AA seqDB search
MTKIKVANPVVELDGDEMTRIIWQFIKDKLILPYLDIDLKYYDLSVENRDKTDDRVTVES
ANAIKQYGVGVKCATITPDEARVTEFNLKKMWKSPNGTIRNILGGTVFREPIVCSNVPRY
VPGWTKPIIIGRHAFGDQYKATDFVVPGKGKLTIKWVPEGGGEPIEHEVYDFPGGGVAMG
MYNLDESIEGFAHSSFMYGLERGYPVYLSTKNTILKAYDGRFKDIFQKVFDEHYAAQFKA
KGLVYEHRLIDDMVASALKWEGGFVWACKNYDGDVESDVVAQGFGSLGLMTSVLITPDGK
TVEAEAAHGTVTRHYREHQKGKETSTNPIASIYAWTQGLAYRGKFDNTPDVVKFAETLER
VCVETVESGFMTKDLAILIGPEQPWLTTKQFLDKLDENLQKKMAAWA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatcaaggtagccaatccggtcgtcgaactcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggacaagctgatcctgccgtacctcgacatcgacctgaaa
tactacgatctcagcgtcgagaaccgcgacaagacggacgaccgggtgacggtcgaatcg
gccaacgcgatcaagcagtacggcgtcggcgtcaagtgcgcgaccatcaccccggacgag
gcgcgggtgacggagttcaatctcaagaagatgtggaagtcgccgaacggcacgatccgc
aacatcctgggcggcaccgtcttccgcgagccgatcgtctgctccaacgttccgcgctac
gttccgggctggaccaagccgatcatcatcggccgccacgccttcggcgaccagtacaag
gccaccgacttcgtcgttcccggcaagggcaagctgaccatcaagtgggtgccggaaggc
ggcggcgagccgatcgagcacgaggtgtacgatttccccggcggcggcgtcgccatgggc
atgtacaacctggacgagtcgatcgagggcttcgcccactccagcttcatgtacggcctg
gagcgcggctacccggtctacctgtccaccaagaacacgatcctcaaggcctatgacggg
cgcttcaaggacatcttccagaaggtgttcgacgagcattacgccgcccagttcaaggcc
aagggcctcgtctacgagcaccgcctgatcgacgacatggtcgcctcggccctgaagtgg
gaaggcggcttcgtgtgggcctgcaagaactacgacggcgacgtggagtcggacgtcgtg
gcgcagggcttcggctcgctgggcctgatgacctcggtgctgatcacgccggacggcaag
accgtcgaggcggaggccgcccacggcacggtgacccgccactaccgcgagcaccagaag
ggcaaggaaacctccaccaacccgatcgcctcgatctacgcctggacgcagggtctggcc
taccgcggcaagttcgacaacacgccggacgtcgtgaagttcgccgagacgctggagcgc
gtctgcgtcgagaccgtcgagtcgggcttcatgaccaaggatctcgcgatcctcatcggt
ccggagcagccctggctgaccaccaagcagttcctcgacaagctggacgagaacctgcag
aagaagatggccgcctgggcgtaa

DBGET integrated database retrieval system