KEGG   Azospirillum sp. TSH58: TSH58p_18655Help
Entry
TSH58p_18655      CDS       T05449                                 

Definition
(GenBank) class II fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00010  Glycolysis / Gluconeogenesis
azt00030  Pentose phosphate pathway
azt00051  Fructose and mannose metabolism
azt00680  Methane metabolism
azt00710  Carbon fixation in photosynthetic organisms
azt01100  Metabolic pathways
azt01110  Biosynthesis of secondary metabolites
azt01120  Microbial metabolism in diverse environments
azt01130  Biosynthesis of antibiotics
azt01200  Carbon metabolism
azt01230  Biosynthesis of amino acids
Module
azt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
azt_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSH58p_18655
   00030 Pentose phosphate pathway
    TSH58p_18655
   00051 Fructose and mannose metabolism
    TSH58p_18655
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TSH58p_18655
   00680 Methane metabolism
    TSH58p_18655
Enzymes [BR:azt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TSH58p_18655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Torsin
Motif
Other DBs
NCBI-ProteinID: AWJ85590
UniProt: A0A2S1XMG8
Position
TSH58_p04:complement(31178..32257)
Genome map
AA seq 359 aa AA seqDB search
MSAPTRLKPGVVTGEDYRALIAACQDGGYALPAVNVVGTNGINAVLEAAAKNRSDVIVQL
SNGGARFYAGEGMKDALQARILGAVSAAQHVHLLAEQYGVCVVLHTDHANKGLIPWVEGM
IGHGEEHFRRTGRPLFSSHMLDLSEESLDFNLSECARILKRLAPLGMSLEIELGVTGGEE
DGIGSEDLDAANNAHLYTQPEDVLRAYEELSPIGHFSVAASFGNVHGVYAPGNVKLRPEI
LGASQSLVSERHGGGAKPLALVFHGGSGSEKEKIAQAVGFGVFKMNIDTDTQFAFAESIG
GFVLENEAAFRHQIDPQSGKPLKKLYDPRKWLRLGEQGMVRRLDEAFADLGAAGKSLAG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccgacccgactgaagcccggcgtcgtgaccggagaggactaccgcgcgctg
atcgccgcctgccaggacggcggttacgctctgccggcggtcaacgtggtcggcaccaac
ggcatcaacgccgtcctcgaagcggcggcgaagaaccgctccgacgtgatcgtgcagctg
tccaacggcggcgcccgcttctacgccggcgaaggcatgaaggacgcgctccaggcccgc
atcctgggcgccgtgtcggcggcccagcacgtccatctgctggccgagcagtacggcgtc
tgcgtcgtcctgcacaccgaccacgcgaacaagggcctgatcccctgggtcgagggcatg
atcggccatggcgaggagcatttccgccgcaccggccgtccgctgttcagctcgcacatg
ctcgacctgtcggaggagtcgctggacttcaacctgtcggaatgcgcccgcatcctcaag
cgcctcgccccgctgggcatgagcctggagatcgagctgggcgtgaccggcggcgaggag
gacggcatcgggtcggaggacctggacgccgccaacaacgcccacctctacacccagccg
gaagacgtgctgcgcgcctatgaggagctgtcgcccatcggccatttctcggtcgcggcc
tccttcggcaacgtgcacggcgtctacgccccgggcaacgtgaagctgcgtccggagatc
ctcggcgcctcgcagtcgctggtgtcggagcgtcacggcggcggcgccaagccgctggcc
ctggtgttccacggcggttcggggtcggagaaggagaagatcgcccaggcggtcggcttc
ggcgtgttcaagatgaacatcgacaccgacacccagttcgccttcgccgagtccatcggc
ggcttcgtgctggagaacgaggcggccttccgtcaccagatcgacccgcagtcgggcaag
ccgctgaagaagctgtacgacccgcgcaagtggctgcgcctgggcgagcagggcatggtc
cgccgtctcgacgaggccttcgccgatctgggcgccgccggcaagtcgctggccggctga

DBGET integrated database retrieval system