KEGG   Azospirillum sp. TSH58: TSH58p_28200Help
Entry
TSH58p_28200      CDS       T05449                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
azt  Azospirillum sp. TSH58
Pathway
azt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TSH58p_28200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:azt02022]
    TSH58p_28200
Two-component system [BR:azt02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   TSH58p_28200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AWJ87276
UniProt: A0A2S1XS07
Position
TSH58_p02:complement(1529791..1530489)
Genome map
AA seq 232 aa AA seqDB search
MTEEDQPHILVVDDDTRLRELLRKYLAGNGFLVATAKDAAEARAKLAGLAFDLLVLDIMM
PGESGLELTESLRRERDLPILLLTARGEPDDRIAGLEAGADDYLAKPFNPRELLLRINSI
LRRQASRPADPAPPQPVKLGPMIYLPDRDELRAGEEVVRLTTAEAGLLRVLAASPGTIFS
REELTERSKVAGNARTIDVQVTRLRRKIEPDPREPRYLHTVRGEGYVLRPDP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaagaccagccccacatcctggtcgtcgatgacgacacccgtctgcgcgaa
ctgctgcgcaagtatctcgccggcaacggcttcctggtcgccaccgcgaaggacgccgcg
gaggcgcgggccaagctggccgggctcgccttcgacctgctggtcctcgacatcatgatg
cccggcgagagcgggctggagctgaccgaatcgctgcggcgggagcgcgacctgccgatc
ctgctgctgaccgcgcggggcgagccggacgaccgcatcgccgggctggaggccggggcc
gacgactacctcgccaagcccttcaacccgcgcgaactgctgctgcgcatcaattcgatc
ctgcgccgccaggccagccgcccggcggacccggcgccgccgcagccggtgaagctcggc
ccgatgatctacctgcccgaccgcgacgagctgcgggcgggcgaggaggtggtccgcctg
accacggcggaggccgggctgctgcgcgtgctcgccgcctcccccggcaccatcttctcg
cgcgaggagctgacggagcgcagcaaggtcgccggcaacgcccgcaccatcgacgtgcag
gtgacccgcctgcgccgcaagatcgaacccgacccgcgggagccgcgttacctccacacg
gtgcgcggcgagggctatgtgttgaggccggacccgtaa

DBGET integrated database retrieval system