KEGG   Azospirillum sp. CFH 70021: DEW08_15960Help
Entry
DEW08_15960       CDS       T05917                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
azz  Azospirillum sp. CFH 70021
Pathway
azz00471  D-Glutamine and D-glutamate metabolism
azz00550  Peptidoglycan biosynthesis
azz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DEW08_15960
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DEW08_15960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azz01011]
    DEW08_15960
Enzymes [BR:azz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     DEW08_15960
Peptidoglycan biosynthesis and degradation proteins [BR:azz01011]
 Precursor biosynthesis
  Amino acid ligase
   DEW08_15960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C IlvN TrkA_N AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD NAD_binding_2 NAD_Gly3P_dh_N NAD_binding_8 MeaB
Motif
Other DBs
NCBI-ProteinID: AWK87514
UniProt: A0A2S2CSM6
Position
2:2033203..2034597
Genome map
AA seq 464 aa AA seqDB search
MIDLFYMQELPVAVMGLGKSGLATADALRRSGAEVRVWDDNPASREQAAEAGYQVVDFAT
ADLSDLTTMVWSPGIPHTFPKPHPVAERARKAGLELVCDIELLARAEREAAFIGITGTNG
KSTTTTLVGHIMDKAGRRVAVGGNLGTPVLTFPPMPAGGTYVLEMSSYQLELTFSITFDV
AVLLNITPDHLARHGGMEGYVAAKRLIFHRQTWPRTAVIGVDDEHCRAIHARLAAAGDQR
IWPVSALGRVEGGVYAEDGWLVDDTEGAAERVAELSRFPALLGTHNWQNAAAAYAACKAA
GVPAAAIVAAMATFPGLAHRQQLVATIDGVRFVNDSKATNADAAEKALATFDPIYWILGG
QAKETGLNGLESYMNRVRHAFLIGEASDRFAIWLDENGVAYTRCGTLDVATAKAAALARR
ESLPGACVLLSPACASWDQFANFEKRGEAFVASVKSLTEGGAAR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctcttctacatgcaggagcttccggtcgcggtgatgggcctcggcaagtcc
gggctcgccaccgccgacgcgctgcggcgcagcggcgccgaggtgcgggtgtgggacgac
aaccccgcctcgcgcgagcaggccgcggaagccggctaccaggtcgtcgacttcgccacc
gccgatctgtcggacctgaccaccatggtgtggtcgcccggcatcccccacaccttcccc
aagccgcacccggtcgccgagcgggcgcgcaaggccgggctggagctggtctgcgacatc
gagctgctggcgcgggccgagcgcgaggccgccttcatcggcatcaccggcaccaacggc
aagtccaccacgacgacgctggtcggccacatcatggacaaggccggccgccgcgtcgcg
gtcggcggcaacctcggcacgccggtgctgaccttcccgccgatgccggccggcggcacc
tatgtgctggagatgtcgagctaccagctggagctgaccttctccatcaccttcgacgtc
gcggtgctgctgaacatcacgcccgaccacctcgcccgccacggcgggatggagggctac
gtcgccgccaagaggctgatcttccaccgccagacctggccgcgcaccgcggtgatcggg
gtggacgacgagcattgccgggcgatccacgcccggctggccgccgccggcgaccagcgc
atctggccggtctccgccctgggccgggtcgagggcggcgtctatgccgaggacggctgg
ctggtcgacgacaccgagggcgcggccgagcgcgtggcggagctgtcgcgcttcccggcg
ctgctcggcacccacaactggcagaacgccgcggcggcctatgccgcctgcaaggcggcc
ggcgtgccggcggcggcgatcgtcgcggcgatggcgaccttccccggcctcgcccaccgg
cagcagctcgtcgcgaccatcgacggggtccgattcgtcaacgacagcaaggcgaccaac
gccgacgcggccgaaaaggcgctggcgaccttcgacccgatctactggatcctcggcgga
caggccaaggagaccgggctcaacggcctggaatcctacatgaatcgcgtccgccacgcc
ttcctgatcggcgaggcgtcggaccgcttcgccatatggcttgatgaaaacggggtagcc
tatacaagatgtggcaccctcgatgttgcgacggcgaaggcggcggcgctcgcccggcgg
gagtccctgcccggcgcctgcgtcctgctgtccccggcctgcgcctcgtgggaccagttc
gcgaatttcgagaagcgcggtgaggcgttcgtggccagcgtgaagtctctgacggagggg
ggtgcggcccgatga

DBGET integrated database retrieval system