KEGG   Brucella abortus A13334: BAA13334_I00717Help
Entry
BAA13334_I00717   CDS       T01704                                 

Definition
(GenBank) oxidoreductase domain-containing protein
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
baa  Brucella abortus A13334
Brite
KEGG Orthology (KO) [BR:baa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAA13334_I00717
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     BAA13334_I00717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEW16810
Position
1:427410..428363
Genome map
AA seq 317 aa AA seqDB search
MAKWGLIGASTIAKEWVIGAIRATGGEVVSVYSTNAARGKTYADENGIARSVTSLDALLA
DPEIDAVYISTTNELHRDKAIAAAQAGKHILCEKPLALTIGDAHEMLKAARAAGVVAGTN
HHLRNAASHRAMRDAVAEGRIGKVLGARVFHAVYLPPHLQGWRIERPDAGGGVVLDITVH
DADTLRFVLGENPVEAVAFSQQGGLSGEGLEDGVMGVLRFPSGAIAQFHDAFTAKYAETG
SGAWQRRFAHCAQCDDAKAGRDRHPAGQGRRTRIAARPQKSLRNRLAGFSRCHCRKRPAI
GHIGGWHLVARHRAGRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtggggccttataggcgcaagcaccattgcaaaggaatgggtgatcggcgcc
attcgcgcgacgggtggcgaggtcgtttccgtctacagcaccaatgccgcgcgcggtaaa
acctatgcagacgagaacggcatcgcccgttcggtgacgagcctcgatgcgctgctggcc
gacccggaaatagacgcggtttatatctccaccaccaatgaactgcatcgcgataaggcc
attgccgcggcacaagcgggcaagcatatcctgtgcgaaaagccgctggcgctgacgatt
ggtgacgctcatgaaatgctgaaagcggcgcgcgcagcgggcgtggtggcaggcaccaat
catcatttgcgcaatgcggcaagccaccgcgccatgcgcgatgccgtagcagaaggccgg
atcggcaaggtgctgggcgcgcgggttttccatgcggtttatttgccgccacacttacag
ggctggcgcattgagcggcccgatgcgggcggcggtgtcgtcctcgatatcactgtgcat
gatgccgatacgctgcgttttgtgctgggggaaaatccggtcgaggcggtcgctttcagt
caacagggcggcttaagtggagaagggctggaagatggcgtgatgggcgttttgcgtttt
ccatccggggcgattgcccagtttcacgatgctttcaccgccaaatatgccgaaaccggt
tcgggtgcatggcagcgaaggttcgctcattgcgcgcaatgtgatgacgcaaaagccggt
cgggaccgtcatcctgcgggacaaggacggcgaacacgaattgccgctcgaccacaaaaa
tctctacgaaaccgccttgcaggcttttcacgatgccattgccggaagaggccagccatc
ggccacattggaggatggcatctggtcgctcgccaccgggctggccgtgcttga

DBGET integrated database retrieval system