KEGG   Brucella abortus A13334: BAA13334_I03434Help
Entry
BAA13334_I03434   CDS       T01704                                 

Definition
(GenBank) Protein apaG
  KO
K06195  ApaG protein
Organism
baa  Brucella abortus A13334
Brite
KEGG Orthology (KO) [BR:baa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BAA13334_I03434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 PUMA
Motif
Other DBs
NCBI-ProteinID: AEW18521
Position
1:2079714..2080106
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETVQLCSRYWQITDANGH
VQEVRGSGVVGKQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMKGEDGAQFEIEIPAFSL
DVPEQRRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgcggtaacacgcgggatcgaagttacggtcgagcccttttatctggaagtc
caatccgagccggaagaaaaccgttatgtatggggttatcgcgtcacgatcgtgaacaac
tcatccgaaacggtgcagctttgctcgcgctactggcagatcaccgacgccaacggccat
gtgcaagaagtgcgcggttcaggcgtggtcggcaagcagcctgttctcgatccgggcgat
tcataccagtattcttccggttgcccgctcacaacctcgtcaggcgtgatggtcgggcgc
taccagatgaagggcgaagacggcgcacaattcgagatcgagattcccgccttttcactc
gacgtacccgaacagcgccgcacgctgaactga

DBGET integrated database retrieval system