KEGG   Brucella abortus A13334: BAA13334_II01454Help
Entry
BAA13334_II01454  CDS       T01704                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baa  Brucella abortus A13334
Pathway
baa00071  Fatty acid degradation
baa00072  Synthesis and degradation of ketone bodies
baa00280  Valine, leucine and isoleucine degradation
baa00310  Lysine degradation
baa00362  Benzoate degradation
baa00380  Tryptophan metabolism
baa00620  Pyruvate metabolism
baa00630  Glyoxylate and dicarboxylate metabolism
baa00640  Propanoate metabolism
baa00650  Butanoate metabolism
baa00900  Terpenoid backbone biosynthesis
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
baa01212  Fatty acid metabolism
baa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA13334_II01454
   00630 Glyoxylate and dicarboxylate metabolism
    BAA13334_II01454
   00640 Propanoate metabolism
    BAA13334_II01454
   00650 Butanoate metabolism
    BAA13334_II01454
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAA13334_II01454
   00072 Synthesis and degradation of ketone bodies
    BAA13334_II01454
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAA13334_II01454
   00310 Lysine degradation
    BAA13334_II01454
   00380 Tryptophan metabolism
    BAA13334_II01454
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAA13334_II01454
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAA13334_II01454
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAA13334_II01454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baa04147]
    BAA13334_II01454
Enzymes [BR:baa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAA13334_II01454
Exosome [BR:baa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA13334_II01454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEW19470
Position
2:928145..929344
Genome map
AA seq 399 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVSIDEQPSKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDIDLFEINEAFAVVAMAAMRDLDLPHEKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERIIRCF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggtggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttagcattgac
gagcagccgagcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatatcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgaaaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatccgatgcttctga

DBGET integrated database retrieval system