KEGG   Brucella abortus A13334: BAA13334_II01538Help
Entry
BAA13334_II01538  CDS       T01704                                 

Definition
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
baa  Brucella abortus A13334
Pathway
baa00230  Purine metabolism
baa01100  Metabolic pathways
Module
baa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:baa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BAA13334_II01538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:baa01002]
    BAA13334_II01538
Enzymes [BR:baa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     BAA13334_II01538
Peptidases [BR:baa01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   BAA13334_II01538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase NAD_synthase Peptidase_C26 tRNA_Me_trans ATP_bind_3 QueC ThiI Asn_synthase PAPS_reduct Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: AEW19523
Position
2:complement(978539..980101)
Genome map
AA seq 520 aa AA seqDB search
MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP
HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP
LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV
HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL
LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE
KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP
ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR
EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF
YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacggcatatcctgacacaatccttatcatcgactttggcagccaggtcacg
cagcttattgcgcggcgtgtgcgcgaggccaatgtctattgcgaaatcgttcccttccag
tctgcggatgaggcgttcaagcggctgcagccgaagggcgtgatcctttccggcagcccg
cattcaacgaccgatatcggttcgccgcgtgcgccgcaggctatttttgatgcgggtatt
ccggttctcggcatttgttatggcgagcagaccatgtgcgcccagcttggcggcaacgtg
gaaagcggccatgatcgtgagttcggccgtgcttttctcgatgtgcaggaagacagtccg
ctctttgccggcatatgggccaagggcacccgccatcaggtctggatgagccatggcgac
cgtgtgacctcgctgccggatggcttcaccatcatcggcacgtcgccgaatgcgccctac
gcggttattgcggatgagaagcgcaaatattacggcgtgcagttccatccggaagttgtg
cacacgccggacggtgcaaagctgttgcagaatttcgttcatcgcattgtcggggtgaag
ccaggctggacgatgggggcctatcgcgaacaggctgtcgaggcgatccgcaaacaggtc
ggcagcggcaaggttatctgcgcgctttcaggcggcgtggattcttccgtggcggcactt
ctggctcatgaagctgtcggcgatcaactgacatgcattctcgttgatcacggcctgatg
cgcaaagacgaagcgcaacaggtcgtggaaatgttccgcgagcattacaatctgccgctg
atcctggtggatgcttccgaccgcttcatcggcgcgcttgagggcgaaagtgacccggaa
aagaagcgcaagaccatcggtcgcctgtttatcgaagtgttcgaggaagaagcaaggaaa
cttggcggcgcggatttcctcgtgcagggtacgctttatcctgacgtgatcgaaagtgtt
tcctttaccggcggcccttcggtcacgatcaagtcgcaccataatgtcggcggtttgccg
gagcgcatgaagatgcagcttgtggagccgctgcgcgagcttttcaaggatgaggttcgt
ctgctcggcaaggaactcggtctgccggacagcttcatcgggcgtcatccgttccccggt
ccgggtcttgcgatccgttgtcccggcggcgtcacgcgcgagaaactggaaatcctgcgc
gaagcggacgcaatctatctggatgaaatccgcaaggctggcctctatgatgcgatctgg
caggctttcgcggttctgcttccggtgcagaccgtgggcgtgatgggggatggccgcact
tacgaattcgtttgcgccttgcgcgcggtgacttcggtggacggcatgacggcggatttc
taccactacgacatgaatttcctcggcaatgcggccacccgcatcatcaacgaagtccgc
ggcatcaaccgcgttgtctatgatgtgacctccaagccgcccggcacgattgagtgggaa
taa

DBGET integrated database retrieval system