KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_232Help
Entry
bbp_232           CDS       T00111                                 

Gene name
gpt
Definition
(GenBank) xanthine-guanine phosphoribosyltransferase
  KO
K00769  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab00230  Purine metabolism
bab01100  Metabolic pathways
bab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    bbp_232 (gpt)
Enzymes [BR:bab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     bbp_232 (gpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran DUF1357
Motif
Other DBs
NCBI-ProteinID: AAO26959
UniProt: Q89AN2
Position
271229..271690
Genome map
AA seq 153 aa AA seqDB search
MSKKYIVTWDMLQIYARELAQKLLPVNQWKGIIAVSRGGLIPSALLARELNIRFVDTICV
SSYDHNRLRDLKILKYAAGNSSQIIIVDDLVDTGGTGKIIRNLYPKAKFVTIFAKPMGKL
LVDEYIIDIPQKVWIEQPWDMGVTYQSPLVRDL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaatatatcgttacttgggatatgctacaaatttatgctagagaattagcc
caaaagctattacctgttaatcaatggaaaggaattattgcagttagtcgtggtggttta
attccgtctgcgttgttagcaagagaattaaatattcgatttgtagatactatttgcgtg
tccagttacgatcataatcgtttacgtgacttaaaaatattaaagtatgcagctggaaac
agttctcaaattattattgtagatgatttagtagatacaggtggaactggaaaaataatt
cgaaatttgtatcctaaagcaaagtttgtaactatctttgccaaacccatgggtaaatta
ttagtagacgaatatattatagatataccacaaaaagtgtggattgagcaaccttgggat
atgggagttacttatcaatctcctttggtaagagatttgtga

DBGET integrated database retrieval system