KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_321Help
Entry
bbp_321           CDS       T00111                                 

Gene name
fabG
Definition
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab00061  Fatty acid biosynthesis
bab00780  Biotin metabolism
bab01100  Metabolic pathways
bab01130  Biosynthesis of antibiotics
bab01212  Fatty acid metabolism
Module
bab_M00083  Fatty acid biosynthesis, elongation
bab_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    bbp_321 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    bbp_321 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    bbp_321 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bab01004]
    bbp_321 (fabG)
Enzymes [BR:bab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     bbp_321 (fabG)
Lipid biosynthesis proteins [BR:bab01004]
 Fatty acid synthase
  Component type
   bbp_321 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 UPF0113_N
Motif
Other DBs
NCBI-ProteinID: AAO27043
UniProt: Q89AG9
Position
372741..373478
Genome map
AA seq 245 aa AA seqDB search
MKTTKKIAVITGANRGLGKGIAEELSNTNNITVIGTSTSQKGCKIINKYLKNNGIGIKLD
ITNPNEITKTMDFVYKNFGRVDILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSK
SVIRNMIKNKQGKIITIGSVIAHIGNCGQTNYSAAKLGLVGFHKSLALELAPKGITVNMI
APGLIKTGMTNNLSQKQLSKYLSKIPMKRLGTIKEISKITLFLISNDANYITGQVIHVNG
GMYMP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccaaaaaaatagctgtaataacaggagctaatcgtgggttaggaaaaggt
attgcagaagaactttcaaacacaaataatataacagtaattggaacatctacctctcaa
aaaggttgcaaaattattaataagtatttaaaaaataatggaatcggcataaagttagat
atcactaatcctaatgaaattactaaaacgatggattttgtttacaaaaatttcggacgc
gttgatattttaatcaataatgcaggtattatacgagataaattattaataaatatgaaa
acacaagattggaattctgtattaaatgttaatttaaattctatattctatatgtctaaa
tctgttataagaaatatgattaaaaacaaacaaggaaaaattataacaataggatctgta
atcgcgcatattggaaattgtggacaaactaattattccgcagcaaaattaggattagta
ggattccacaaatcattagcattagaattagcacctaaaggaatcactgtaaatatgatt
gcaccagggttaataaaaaccggtatgaccaacaatcttagccaaaaacaattaagtaaa
tatctttcaaaaataccgatgaaaagattgggaacaattaaagaaatttctaaaataacg
ttatttttaatttctaatgatgctaattatattacaggacaagtgattcatgttaatggc
gggatgtacatgccatga

DBGET integrated database retrieval system