KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_321Help
Entry
bbp_321           CDS       T00111                                 

Gene name
fabG
Definition
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab00061  Fatty acid biosynthesis
bab00780  Biotin metabolism
bab01040  Biosynthesis of unsaturated fatty acids
bab01100  Metabolic pathways
bab01130  Biosynthesis of antibiotics
bab01212  Fatty acid metabolism
Module
bab_M00083  Fatty acid biosynthesis, elongation
bab_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bab00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    bbp_321 (fabG)
   01040 Biosynthesis of unsaturated fatty acids
    bbp_321 (fabG)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    bbp_321 (fabG)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    bbp_321 (fabG)
Enzymes [BR:bab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     bbp_321 (fabG)
Lipid biosynthesis proteins [BR:bab01004]
 Fatty acid synthase
  Component type
   bbp_321 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Motif
Other DBs
NCBI-ProteinID: AAO27043
UniProt: Q89AG9
Position
372741..373478
Genome map
AA seq 245 aa AA seqDB search
MKTTKKIAVITGANRGLGKGIAEELSNTNNITVIGTSTSQKGCKIINKYLKNNGIGIKLD
ITNPNEITKTMDFVYKNFGRVDILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSK
SVIRNMIKNKQGKIITIGSVIAHIGNCGQTNYSAAKLGLVGFHKSLALELAPKGITVNMI
APGLIKTGMTNNLSQKQLSKYLSKIPMKRLGTIKEISKITLFLISNDANYITGQVIHVNG
GMYMP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccaaaaaaatagctgtaataacaggagctaatcgtgggttaggaaaaggt
attgcagaagaactttcaaacacaaataatataacagtaattggaacatctacctctcaa
aaaggttgcaaaattattaataagtatttaaaaaataatggaatcggcataaagttagat
atcactaatcctaatgaaattactaaaacgatggattttgtttacaaaaatttcggacgc
gttgatattttaatcaataatgcaggtattatacgagataaattattaataaatatgaaa
acacaagattggaattctgtattaaatgttaatttaaattctatattctatatgtctaaa
tctgttataagaaatatgattaaaaacaaacaaggaaaaattataacaataggatctgta
atcgcgcatattggaaattgtggacaaactaattattccgcagcaaaattaggattagta
ggattccacaaatcattagcattagaattagcacctaaaggaatcactgtaaatatgatt
gcaccagggttaataaaaaccggtatgaccaacaatcttagccaaaaacaattaagtaaa
tatctttcaaaaataccgatgaaaagattgggaacaattaaagaaatttctaaaataacg
ttatttttaatttctaatgatgctaattatattacaggacaagtgattcatgttaatggc
gggatgtacatgccatga

DBGET integrated database retrieval system