KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_462Help
Entry
bbp_462           CDS       T00111                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bab00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    bbp_462 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bab03011]
    bbp_462 (rplV)
Ribosome [BR:bab03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    bbp_462 (rplV)
  Bacteria
    bbp_462 (rplV)
  Archaea
    bbp_462 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAO27168
UniProt: P59558
Position
complement(526104..526463)
Genome map
AA seq 119 aa AA seqDB search
METIARHSQARSSAQKLRLVADLIRGKNIEHALNILTFCNKKASILVKKVLKSAISNAEH
NHGSDINNLQVKKILIDEGPTMKRMMPRAKGRSDRILKRTSHITIVVSDSKVKDKKGRG
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaattgctagacatagtcaagctcgttcttcagctcaaaaattacgtttagta
gctgatttaattcgaggaaaaaatatagaacatgcattaaatattttaactttttgtaat
aaaaaggcatcaattttagtaaaaaaagttttgaaatctgcaatttcaaatgctgagcat
aatcatggatctgatataaataacttacaagttaaaaaaattttaattgacgaagggcca
actatgaaacgaatgatgccacgtgctaaaggtcgttcagatcgtattttaaaacgtact
agtcacattactatagtagtttctgatagtaaagtaaaagataaaaaaggtagaggttaa

DBGET integrated database retrieval system