KEGG   Brucella abortus BDW: DK48_1051Help
Entry
DK48_1051         CDS       T03462                                 

Definition
(GenBank) alcohol dehydrogenase GroES-like domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
babb  Brucella abortus BDW
Pathway
babb00010  Glycolysis / Gluconeogenesis
babb00071  Fatty acid degradation
babb00350  Tyrosine metabolism
babb00625  Chloroalkane and chloroalkene degradation
babb00626  Naphthalene degradation
babb01100  Metabolic pathways
babb01110  Biosynthesis of secondary metabolites
babb01120  Microbial metabolism in diverse environments
babb01130  Biosynthesis of antibiotics
babb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK48_1051
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK48_1051
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DK48_1051
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK48_1051
   00626 Naphthalene degradation
    DK48_1051
Enzymes [BR:babb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DK48_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-ProteinID: AIJ52223
UniProt: O54388
Position
1:1077117..1077881
Genome map
AA seq 254 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQTGRFTLSQSPEIRKRKILRAALARYGPEIQIFCRRHRWMQLSFSHPPGSSFQPPCV
RCARAAGWSAAASI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcagacagggaggtttacgctttcacaaagcccggagatacggaagcgaaag
attttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtcac
cgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgtg
cggtgcgcaagggcggccgggtggtctgcggcggcatccatatga

DBGET integrated database retrieval system