KEGG   Brucella abortus BDW: DK48_2503Help
Entry
DK48_2503         CDS       T03462                                 

Gene name
ribF
Definition
(GenBank) riboflavin biosynthesis protein RibF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
babb  Brucella abortus BDW
Pathway
babb00740  Riboflavin metabolism
babb01100  Metabolic pathways
babb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    DK48_2503 (ribF)
Enzymes [BR:babb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     DK48_2503 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     DK48_2503 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AIJ51315
UniProt: A0A4V1ZF33
Position
2:complement(424317..425306)
Genome map
AA seq 329 aa AA seqDB search
MKKSSFQRLTGTEGLPPALHDCVVAIGNFDGVHRGHQAVLERALELAERESRPAVVLTFE
PHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAEFSQRSAEDFVQHILVEKL
RASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDAFTDEGGMLVSSTRIRNLLSE
GEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMALAPQTSLKHGIYAVRFRLDDAM
LYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGKTAAVSFFGFLRGEVKFDGLDPLID
QMKQDEAQARALLADVRPISGLDRMLSFN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcaagctttcagcgcctcaccggaaccgagggtttgccgccagccctgcat
gattgcgtggtggcaatcggcaatttcgacggtgtgcatcgcggccaccaggctgttctg
gagcgggcgcttgagcttgccgagcgtgagagccggcctgcggtcgtgctgaccttcgag
ccgcatccgcgcagtttcttcaagcaggaccagcctgtcgatcgcctgaccgatgcggcg
gaaaaggccgaaatcctgcgcctcatgggctttgacgccgtgatggaacagccttttacg
gcagagttttcgcagcgttcggcggaagatttcgttcagcatattcttgttgaaaagctg
cgtgcgagccgcgtcgtcaccggttatgactttcatttcggcaagggacggcgcggcacg
ccggaattcctgtgcgaggcggggaaaaaggccgggttcagtgttacgctggtcgatgcc
ttcaccgatgagggcgggatgctcgtttcttcaacgcgcatccgcaatctcttgagcgag
ggtgaagtggctgaggctgccggacttctcggctatcgctaccgcatatgcggggaggtg
atccacggcaagaagcttggccggacgcttggttttccaacagccaatatggcgcttgca
ccgcagacaagtctcaagcacggcatttatgcggttcgcttccggttggatgacgccatg
ctttatgacggcgtggcaagtttcgggcgaagacccacagtggacgacgaaggcgcgcct
cttctcgaaacctttctcttcgatttttccggcgacctttacggaaagaccgcagccgtt
tccttcttcggtttcctgcggggcgaggtgaaattcgacggcctcgatccgctgatcgat
cagatgaagcaggatgaggcgcaggcgcgcgcgcttctcgccgatgtccggcctatctcg
gggctcgaccggatgctctccttcaactga

DBGET integrated database retrieval system