KEGG   Brucella abortus BDW: DK48_2640Help
Entry
DK48_2640         CDS       T03462                                 

Gene name
psald
Definition
(GenBank) phenylserine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
babb  Brucella abortus BDW
Pathway
babb00260  Glycine, serine and threonine metabolism
babb01100  Metabolic pathways
babb01110  Biosynthesis of secondary metabolites
babb01120  Microbial metabolism in diverse environments
babb01130  Biosynthesis of antibiotics
babb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DK48_2640 (psald)
Enzymes [BR:babb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DK48_2640 (psald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIJ51388
UniProt: A0A4Q5MG08
Position
2:564858..565907
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNELFEREVAVFFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDGCGAPEYFTGGARLHPIDGALGRIDPELLKRE
LKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRDAGLPLHMDGARFANALV
SLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLAWKPEANEVFAIMKQSVYDR
LRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTSFANTEEEVDRFGDMIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccatccaaaaatcgccgagagcctttcg
ctgcatgcagccggttttgcggcagcctatggcgcaagcgagatcgacaaacgtgtggaa
caacacttcaatgaattgttcgagcgtgaagtggccgttttctttgtcggaaccggtacg
gctgccaattcgctggcgctggccagcgtcaaccggcccggcggcgtttcgctggtccac
cgcgaggcgcatgtgatcgaggatggatgcggcgcaccggaatatttcaccggcggcgca
cgtctccacccgatcgacggcgcgctgggccgcattgatcccgaacttctgaaacgcgaa
ttgaagcgtttcaaccccgccttcgttcacgcgggccagcccatggccgtcagcatcacg
caggcgacggaagtgggtacgctttaccagccggagcatatcgccaccatttcgcaaatc
tgccgcgatgccggactgccgctacacatggatggcgcacgctttgccaatgcgctcgtg
tcgcttgatctcacacctgccgaaatgacatggaaacttggcgtggacattgtgtccttc
ggcggcaccaagaatggctgctggtgcgccgaggcgctggtcttcatggacccggcccgc
gccaaagacctgcccttcatccgcaagcgcgcagcacagcttttctccaagacgcgcttc
gttgccgcgcagttcgatgcctatctgcgtgacgatctctggcgcgaccttgcccgccat
tccaacgcgcttgctgcccgccttgccaaccatatccatgcatcaagccagatgcgcctt
gcctggaaaccggaagccaacgaggttttcgcgatcatgaagcaatcggtttatgaccgt
ctgcgcgatgcgggtgcggtattctacgactggaatcctccgcattcggaagtgggccgc
atcggcgagggcgagatttttgcccgctttgtcaccagcttcgccaatacggaagaagaa
gtggaccgtttcggcgacatgatcgcctga

DBGET integrated database retrieval system