KEGG   Brucella abortus BDW: DK48_3004Help
Entry
DK48_3004         CDS       T03462                                 

Definition
(GenBank) D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase family protein
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
babb  Brucella abortus BDW
Pathway
babb00030  Pentose phosphate pathway
babb01100  Metabolic pathways
babb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DK48_3004
Enzymes [BR:babb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     DK48_3004
    4.1.2.22  fructose-6-phosphate phosphoketolase
     DK48_3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AIJ51402
UniProt: A0A4Q2TKY2
Position
2:complement(947398..949776)
Genome map
AA seq 792 aa AA seqDB search
MSTVPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQPEHIKPRLLGHWGT
TPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTYSEIYPAISEDEAGME
RLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAET
GALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARLSDDDLDNLFRGYGYEPFFV
EGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPRWPMIILRSPKGWTGPKTVDGL
VVENYWRAHEVPVANCRENDAHRKILEDWMKSYDPSDLFDEKGALKPELRALAPKGEARI
GANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEAQSTKILGDFLRDVMKLNETEKNFRI
FGPDETASNRLGSVLEATNRVWMAETLDMDDHLAADGRVMEVLSEHLCQGWLEGYLLSGR
HGFFSCYEAFIHIIDSMFNQHAKWLQVARELEWRKPISSLNYLLTSHVWRQDHNGFSHQD
PGFVDLVANKSADIARVYFPPDANTLLWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAE
KHCEAGLGIWEWAGTEDGLEPDIVMACAGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDL
MVLQSPHQHPHGISDEEFDRMFTTNRPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQ
GTTTTPFDMTVLNELDRFHLAMEAVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDM
PEIRDWKWTWPR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgccagcaaaagggcctctcacaccgcagcagctttcactcatcaaccgt
tactggcgcgcggcgaattatctttccgtcggccagatttatctgatgaaaaatcccctg
ttgcgcgaaccgctccagcctgagcacatcaagccgcggcttctcggccattggggcacg
acacccggcctcaatttcatctatgcgcatctcaaccgcattattcagcagcgcaacgcc
aatgtgatctatatttgcggccccggccatggcgggccgggcatggtggccaacacctat
ctggagggcacctattccgaaatctatcccgcaatcagcgaagatgaagcgggcatggaa
aggctcttccgccagttttccttccccggcggaataccaagccatgccgcgccggaaaca
ccgggctctatccacgaagggggcgaactgggttatgcgctcgtccacgcctatggtgcg
gccttcgacaatcccgatctggtggtggcctgcgtcgtgggcgacggagaagcggaaacc
ggcgcgcttgcaacttcgtggcactccaacaaattcctcaatccggcgcgcgatggtgcg
gttctgccgatcctgcatctcaatggctacaagatcgccaaccccaccgtgctggcccgc
ctttcggatgatgatctggacaatcttttccgtggctacggttatgagcctttctttgtt
gaaggcagcgagcctgccgacatgcaccagaagatggccgcaacactggacacgattttc
cagcgcattcaggacatcaagaaaaatgccgatgtgcactcgcccgagcgcccgcgctgg
ccgatgattattctcagaagcccgaagggctggaccggcccaaaaaccgtggacggtctg
gttgttgaaaactattggcgcgcccatgaggtgccggttgccaattgccgcgaaaacgat
gcccatcgcaaaatcctcgaagactggatgaagagttacgacccgtccgatctgttcgac
gaaaaaggggcgctgaagcctgaattgcgggcgctggcgccaaagggtgaagcgcgcata
ggggccaatccgcatgccaatggcgggctcttgcgtaaagagcttcacatgccggatttc
cgccaatatgcggtcaatgtcaccgaaccgggagcgatagaagcgcaatcaaccaaaata
ttgggcgattttctgcgcgatgtgatgaaactgaacgagacggaaaagaacttccgcatc
ttcggccccgacgaaaccgcctccaacaggctcggcagcgtattagaggcgacgaaccgg
gtctggatggccgaaacgctggacatggatgaccacctcgccgccgacgggcgtgtaatg
gaggttctcagcgaacatctctgccagggctggcttgaaggctatcttctcagtggccgg
cacggcttcttttcctgctacgaagccttcatccacattatcgattccatgttcaaccaa
catgccaaatggttgcaggttgcgcgcgaactggaatggcgcaagcccatctcatcgctc
aattatctgctgacctcccatgtctggcggcaggaccataacggcttctcccatcaggat
cccggcttcgtcgatctcgtcgccaacaaaagcgccgatatcgcgcgtgtctatttcccg
ccggatgccaacacccttttgtgggtgggagatcactgcctgaaaacctggaaccgcgtg
aatgtcatcgtggcgggcaagcagccggaaccgcaatggctgaccatggcggaggctgag
aaacattgcgaagcaggtctcggcatatgggaatgggcgggtacggaagacgggctggag
ccggatatcgtcatggcctgcgcgggcgatgtgccgaccatggaaacgcttgccgcggtt
gatcttctgcgccagtccctgccgcatctgcgcattcgcgtggtgaatgtggttgacctc
atggtgctgcaatcgccgcatcagcacccgcatggcatttccgatgaggaattcgaccgg
atgttcaccaccaacaggcccgtcatcttcgcctatcacggctatccttatctcatccat
cgactggtctataagcgcaccaaccactccaatttccacgttcgtggttttatcgagcag
ggaacgaccacaacgcctttcgacatgaccgtgctgaacgagctggatcgtttccacctc
gcgatggaagccgtcgagcgcctgccgctgggcgaaagcgttgccaaacccctgatcgac
aatttcacggagaaacttgcgctgcataaggactatatccgacagcatggtgaggacatg
ccggaaatccgcgactggaaatggacatggccgcgataa

DBGET integrated database retrieval system