KEGG   Brucella abortus BDW: DK48_533Help
Entry
DK48_533          CDS       T03462                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
babb  Brucella abortus BDW
Pathway
babb00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    DK48_533
Enzymes [BR:babb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     DK48_533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N F420_oxidored AdoHcyase_NAD 2-Hacid_dh_C THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AIJ52847
Position
1:complement(544424..545218)
Genome map
AA seq 264 aa AA seqDB search
MAYDAFAEFRLTGHNVIITGGAQNIGAGIAKTLSGAGAKVMIADLNGDKARQTAAAIQKE
TGNECHGMKCDVTSLSDIEQVVRETVSAFGGISTLVNNVGWGGRHEDPTAISEEDFIAAY
KLNTISAYRMSMACLPHLLKSQNATITNSGSFSSAVPAYDILAYGTAKAALNQMMVSLAH
MLAKKVRINSVLIGTVMTEGYGSAGIDEEMQEKLRHPDNLTGRAGRPEDIANTMLWLCSP
ASGWVSGQTINVHGGGGVTRLFGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgatgcatttgccgaatttcgcttgacgggccacaatgtcatcatcaccggc
ggcgcacagaatataggcgcaggcattgcgaaaaccctgtcaggcgcaggcgcaaaggtg
atgatcgccgacctcaacggcgacaaggccaggcaaacggcggcagcaatccagaaagaa
accggcaatgaatgccatggcatgaagtgcgacgtcacttcacttagcgatatcgaacag
gtggtgcgcgaaaccgtctcggcttttggcggcatttcaaccctcgtcaacaatgtcggc
tggggcgggcgccatgaagacccgacagcgatcagcgaggaagatttcatcgcagcctat
aagctgaatacgatcagcgcctaccgcatgagcatggcttgcctgccgcatctgcttaaa
tcgcaaaacgcgacgatcaccaattccggctctttctcctctgctgtgccagcctatgac
attctggcctatggaacggcgaaagctgccctcaaccagatgatggtttcgctggctcat
atgctggcaaagaaggtgcgcatcaattccgtgctgatcggcacggtgatgacagaaggt
tacggttcagccggcatcgacgaggaaatgcaggaaaagctgcgccatcccgataacctt
accgggcgtgccggacgacccgaagatatcgccaataccatgttgtggctgtgctcgccc
gccagcggatgggtcagcggccagactatcaatgtgcatggcggcggcggcgtcacgcgc
ctcttcggcaggtga

DBGET integrated database retrieval system