KEGG   Brucella abortus NCTC 10505: DO78_1928Help
Entry
DO78_1928         CDS       T03686                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00010  Glycolysis / Gluconeogenesis
babc00020  Citrate cycle (TCA cycle)
babc00620  Pyruvate metabolism
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01120  Microbial metabolism in diverse environments
babc01130  Biosynthesis of antibiotics
babc01200  Carbon metabolism
Module
babc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:babc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DO78_1928 (pckA)
   00020 Citrate cycle (TCA cycle)
    DO78_1928 (pckA)
   00620 Pyruvate metabolism
    DO78_1928 (pckA)
Enzymes [BR:babc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     DO78_1928 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AIJ58319
Position
1:complement(1947412..1948887)
Genome map
AA seq 491 aa AA seqDB search
MKETGIHNKAASISTSGLKELSAVFYNLGPARLYEETIRRGEAELSAQGALVARTGQHTG
RSPKDKFVVRDANTEDHVWWDNNKPMTPEAFELLYADFIEHAKGRELFVQDLIGGADADN
KINARVITEYAWHSLFIRNLLIRPSQEALASYVPEMTIIDLPSFKADPERYGVRTETVIA
VDLTRKIVLIGGTSYAGEMKKSVFTALNYILPAKGVMPMHCSANEGPNGDTAVFFGLSGT
GKTTLSADPTRTLIGDDEHGWGEHGVFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLE
NVVLDENRQPDFDDGSLTENTRCAYPLGFIPNASKSGKGGQPKNIIMLTADAFGVMPPIA
KLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRKLIAEH
KVDCWLVNTGWTGGAYGVGKRMPIKATRALLAAALDGSLNNAEFRIDPNFGFAVPVEVPG
VESSILDPRST
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaccggcatccacaataaggccgcttcgatttccacttcgggactgaaggaa
ctctccgcagtcttctacaatctcgggccggcacggctttatgaagagaccattcgccgg
ggcgaagcggagctttccgcgcagggcgcgctcgttgcccgtaccggccagcacacgggc
cgttcgccgaaagacaagttcgtcgtgcgcgacgccaataccgaagatcatgtgtggtgg
gacaacaacaagcccatgacgccggaagcttttgagcttctctatgccgatttcatcgaa
catgcgaagggcagggagcttttcgttcaggatctcatcggcggcgcggatgccgacaac
aagatcaacgcccgcgtcatcaccgaatatgcttggcattcgctgttcatccgcaatctg
ctgatccgtccgtcgcaggaagcccttgcttcctacgtgccggaaatgaccatcatcgac
ctgccgtccttcaaggctgacccggaacgctatggcgtgcgcaccgaaacggtgatcgcg
gtcgatcttacccgcaagatcgtgctgatcggcggcacgtcctatgcgggcgagatgaag
aagtccgtcttcaccgcgctcaactatatcctgcctgccaagggcgttatgccgatgcac
tgttcggccaatgaaggcccgaacggcgacacggcggttttcttcggtctttcgggcacc
ggcaagaccacgctttccgccgatccgacgcgcacgctgatcggtgacgacgaacatggc
tggggcgaacatggcgtcttcaattttgaaggcggctgctatgccaagaccatccgtctt
tccgccgaagcagaaccggaaatctatgccacgacgcaacgtttcggcacggttctggaa
aatgtcgtgctggacgagaatcgccagccggatttcgacgatggttcgctgacggaaaac
acgcgctgcgcctatccgctgggtttcatccccaacgcctcgaaatcgggcaagggcggc
cagccgaagaatatcatcatgctcaccgccgatgccttcggcgtgatgccgcccatcgcc
aagctgacgccggcgcaggccatgtatcacttcctgtccggctataccgccaaggtggca
ggcacggaaaagggcgtgacggaaccggaggcaaccttctccacctgcttcggtgcgcct
ttcatgccgcgccatccttcggaatatggcaacctgttgcgcaagctgattgccgagcac
aaggttgattgctggctggtcaataccggctggacgggcggcgcttacggcgttggcaag
cggatgccgatcaaggcaacccgcgcgcttctggcagcggccctcgacggctcgctgaac
aatgctgaattccgcatcgatccgaatttcggcttcgccgtccctgtcgaagtgccgggt
gtggaaagctccattctcgatccgcgctcgacctga

DBGET integrated database retrieval system