KEGG   Brucella abortus NCTC 10505: DO78_2304Help
Entry
DO78_2304         CDS       T03686                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00071  Fatty acid degradation
babc00072  Synthesis and degradation of ketone bodies
babc00280  Valine, leucine and isoleucine degradation
babc00310  Lysine degradation
babc00362  Benzoate degradation
babc00380  Tryptophan metabolism
babc00620  Pyruvate metabolism
babc00630  Glyoxylate and dicarboxylate metabolism
babc00640  Propanoate metabolism
babc00650  Butanoate metabolism
babc00900  Terpenoid backbone biosynthesis
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01120  Microbial metabolism in diverse environments
babc01130  Biosynthesis of antibiotics
babc01200  Carbon metabolism
babc01212  Fatty acid metabolism
babc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DO78_2304
   00630 Glyoxylate and dicarboxylate metabolism
    DO78_2304
   00640 Propanoate metabolism
    DO78_2304
   00650 Butanoate metabolism
    DO78_2304
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DO78_2304
   00072 Synthesis and degradation of ketone bodies
    DO78_2304
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DO78_2304
   00310 Lysine degradation
    DO78_2304
   00380 Tryptophan metabolism
    DO78_2304
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DO78_2304
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DO78_2304
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DO78_2304
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babc04147]
    DO78_2304
Enzymes [BR:babc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DO78_2304
Exosome [BR:babc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DO78_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ59129
Position
2:complement(236695..237894)
Genome map
AA seq 399 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVSIDEQPSKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDIDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERIIRCF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttagcattgac
gagcagccgagcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatatcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatccgatgcttctga

DBGET integrated database retrieval system