KEGG   Brucella abortus NCTC 10505: DO78_2340Help
Entry
DO78_2340         CDS       T03686                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00270  Cysteine and methionine metabolism
babc00920  Sulfur metabolism
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01130  Biosynthesis of antibiotics
babc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:babc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DO78_2340 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DO78_2340 (metA)
Enzymes [BR:babc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     DO78_2340 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     DO78_2340 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AIJ59418
Position
2:complement(269098..270018)
Genome map
AA seq 306 aa AA seqDB search
MPIKIPDDLPATSVLEAEGVMVMREADAVRQDIRPLRIGLLNLMPNKVTTETQIARLLGA
TPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQRFDGFVITGAPVERLPFEEVTY
WDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDLPAKASGVFRQRSLVPASPYL
RGFSDDFAIPVSRWTEVRKSDIPADSGLKVLVDSTETGLCLLDDPRHRSLHMFNHVEYDT
TSLADEYFRDIQVQPEAKVPVNYFPGDDAKRPPENRWRSHAHLLFGNWINEMYQSTPYDI
ERIGKV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattcctgacgatctgcctgcaaccagcgtactcgaagccgagggcgtg
atggtgatgcgtgaggccgatgccgtacgtcaggatattcgtccgctgaggattggcctt
ctcaatctgatgcccaacaaggtaacgaccgagacgcagattgcacgtcttcttggtgcg
acgccgcttcaggtggagctgacgctcgtgcgcatgaccaaccacgtcgcgcgccacaca
ccagccgaccacatgctctccttctattgcccttgggaggaggtgaacgaccaacggttc
gacggttttgtgattaccggcgcgccggtcgagcggctgcccttcgaggaagtcacctac
tgggatgaaatgcggcgcgtatttgactggacgcagagccatgtgcaccgcacgctgaac
atttgctgggccgcgcaggctgcggtctatcatttccacggcatgaaaaaatatgacctg
ccggcaaaagcatcaggggtgttccgccagcgcagtctcgtgccggcatctccttatctg
cgtggtttttcagacgattttgccattccggtttcgcgctggaccgaagtgcgaaagtcc
gacattccggctgatagcgggctgaaggttctggtggacagcaccgaaacgggcctttgc
ctgcttgatgatccgcgccaccgctcgcttcatatgttcaaccatgtcgaatacgacacg
acctcgcttgcagacgaatatttccgcgatattcaggtgcagccggaggcaaaagtacct
gtgaactatttccccggtgatgacgccaagcgcccgccggaaaatcgctggcgcagccat
gcgcatcttcttttcggcaactggatcaacgaaatgtaccagtccacgccctatgatata
gagcggatcggcaaggtctga

DBGET integrated database retrieval system