KEGG   Brucella abortus bv. 2 86/8/59: DK55_1067Help
Entry
DK55_1067         CDS       T03321                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00010  Glycolysis / Gluconeogenesis
babo00071  Fatty acid degradation
babo00350  Tyrosine metabolism
babo00625  Chloroalkane and chloroalkene degradation
babo00626  Naphthalene degradation
babo01100  Metabolic pathways
babo01110  Biosynthesis of secondary metabolites
babo01120  Microbial metabolism in diverse environments
babo01130  Biosynthesis of antibiotics
babo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK55_1067
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK55_1067
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DK55_1067
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK55_1067
   00626 Naphthalene degradation
    DK55_1067
Enzymes [BR:babo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DK55_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIJ93041
Position
1:complement(1069867..1070136)
Genome map
AA seq 89 aa AA seqDB search
MRAVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTH
TTIYPLESANEALADLRSGRLSGAAVLVP
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatatt
ccatccatgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctc
acccggaacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcac
accacaatctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgc
ctcagcggggcggctgttcttgtgccatag

DBGET integrated database retrieval system