KEGG   Brucella abortus bv. 2 86/8/59: DK55_225Help
Entry
DK55_225          CDS       T03321                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00730  Thiamine metabolism
babo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DK55_225 (tenA)
Enzymes [BR:babo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     DK55_225 (tenA)
Transcription factors [BR:babo03000]
 Prokaryotic type
  Other transcription factors
   Others
    DK55_225 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AIJ91829
Position
1:complement(244012..244710)
Genome map
AA seq 232 aa AA seqDB search
MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKAAFLHYLRQDYVYLHHY
ARAFALGVVKANTSQETRLCADIMHSLTHMELPLHVRICAREGISEDALYATREEPENLA
YTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATARAGTPYQEWIDTYAGSEYQDM
CRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASRLEADFWSMGLKAGS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgccacagccgcattactcatccgaacttttcacgcgccttcgcactgccacg
cttgccgactggaagccctatatcgagcacgacttcgtgcgggggcttggcgacggcacg
ctaccgaaagccgccttcctgcattatctccggcaggattatgtctatctgcatcattat
gcccgcgcctttgcgctgggcgtggtcaaggccaatacatcgcaggaaacgcggctttgc
gccgacatcatgcacagtctcacccatatggaactgcctttgcatgtgcgcatctgcgcc
cgtgaaggcatcagcgaagacgcgctttacgccacgcgggaggaaccggaaaaccttgct
tatacgcgctatgtgctcgattgcggacaggcaggcgattttctcgatctgctgacagca
cttgtgccttgcgcgcacggctatggcgagatcggcctcaaccttgccgccacggccagg
gcgggcacgccctatcaggaatggatcgatacctatgccgggtctgaatatcaggacatg
tgccgcacggtcggcaggcttttcgatcaggccgcaagggaccgcatcggcgacgatttc
gagaaaagcccgcgctggccaaaactctgccagatttttgccacggcaagcaggctcgaa
gccgatttctggtccatgggcttgaaggccggatcgtga

DBGET integrated database retrieval system