KEGG   Brucella abortus bv. 2 86/8/59: DK55_2430Help
Entry
DK55_2430         CDS       T03321                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00071  Fatty acid degradation
babo00072  Synthesis and degradation of ketone bodies
babo00280  Valine, leucine and isoleucine degradation
babo00310  Lysine degradation
babo00362  Benzoate degradation
babo00380  Tryptophan metabolism
babo00620  Pyruvate metabolism
babo00630  Glyoxylate and dicarboxylate metabolism
babo00640  Propanoate metabolism
babo00650  Butanoate metabolism
babo00900  Terpenoid backbone biosynthesis
babo01100  Metabolic pathways
babo01110  Biosynthesis of secondary metabolites
babo01120  Microbial metabolism in diverse environments
babo01130  Biosynthesis of antibiotics
babo01200  Carbon metabolism
babo01212  Fatty acid metabolism
babo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK55_2430
   00630 Glyoxylate and dicarboxylate metabolism
    DK55_2430
   00640 Propanoate metabolism
    DK55_2430
   00650 Butanoate metabolism
    DK55_2430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK55_2430
   00072 Synthesis and degradation of ketone bodies
    DK55_2430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK55_2430
   00310 Lysine degradation
    DK55_2430
   00380 Tryptophan metabolism
    DK55_2430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK55_2430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK55_2430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK55_2430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babo04147]
    DK55_2430
Enzymes [BR:babo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK55_2430
Exosome [BR:babo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK55_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIJ90836
Position
2:341800..343008
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLSPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
agcccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system