KEGG   Brucella abortus bv. 2 86/8/59: DK55_2493Help
Entry
DK55_2493         CDS       T03321                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00260  Glycine, serine and threonine metabolism
babo00630  Glyoxylate and dicarboxylate metabolism
babo00670  One carbon pool by folate
babo01100  Metabolic pathways
babo01110  Biosynthesis of secondary metabolites
babo01130  Biosynthesis of antibiotics
babo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DK55_2493 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DK55_2493 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DK55_2493 (gcvT)
Enzymes [BR:babo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     DK55_2493 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AIJ91633
Position
2:406853..407956
Genome map
AA seq 367 aa AA seqDB search
MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHLHTRDHAGLFDISHMKL
VEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLDDLIVTRLGEDRFMVVANA
GNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAKAVITDAGLPGADLAFMSGFEPKQ
GWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVEWIGLAARDSLRLEAGLCLHGQD
ITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAIAKGASAKRVGLKPEGRQPVRAGAD
LFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASLATPGTRVFADVRGNKVPVDVHALPFT
PHRYRKG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggcgataccgcacatttgaataccctgccgttgcaggatctgcatgaaaaggctggc
gcgcgcttcggcggctttgccggctggaacatgccaatcacctatccgctgggtgtgatg
aaggaacatcttcatacgcgcgaccatgcgggcctcttcgacatttcccacatgaagctg
gtggaagtttccggcgcggatgccgccgcgcttctcgccgagacctgcccgctcgatccg
acgatcctgaagacgggccagtcgaaatatacgttcttcctcaatgataatggcggcgtg
ctggatgatctcatcgtcacgcgccttggcgaagaccgtttcatggttgttgccaatgcg
ggcaatgccgatgccgacatcgagcatctcaatgaagccgcgtcgggcaaggccgtaaag
gttaatccgctcgaccgtgttttccttgctttgcaggggccggaagcaaaagctgtcatc
accgatgccggtctgccgggcgccgatcttgccttcatgagcggtttcgagccgaaacag
ggctggttcatgacccgttcgggctataccggcgaagacggtttcgagattggcctgcct
gccgatgaagcccgtgcgctggccgaaaagcttcttgccgatgaacgtgtcgaatggatc
ggccttgccgcccgcgattccttacgcctcgaagcgggcctctgcctgcacggtcaggac
atcacgccggaaaccgatccggtttcggctggcctcacctgggcgatcaccaaggctgtg
cgcgaaaaagccgccttcaacggcgcgaaagccgttctcgacgccattgccaaaggcgcc
agcgccaagcgcgtcggcctcaagccggaaggccgccagccggtgcgcgccggggccgac
cttttcgacgaaagtggccgccagatcggcaccgtcacctcgggcggctttggcccttcc
gccggtttcccggtcgccatgggctatgtcgaggcaagcctcgccacccccggcacccgt
gtttttgcagatgttcgcggcaacaaggttcccgttgacgtccacgcacttcccttcaca
ccgcatcgctatcgcaaaggatga

DBGET integrated database retrieval system