KEGG   Brucella abortus bv. 2 86/8/59: DK55_2954Help
Entry
DK55_2954         CDS       T03321                                 

Gene name
gpm1
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00010  Glycolysis / Gluconeogenesis
babo00260  Glycine, serine and threonine metabolism
babo00680  Methane metabolism
babo01100  Metabolic pathways
babo01110  Biosynthesis of secondary metabolites
babo01120  Microbial metabolism in diverse environments
babo01130  Biosynthesis of antibiotics
babo01200  Carbon metabolism
babo01230  Biosynthesis of amino acids
Module
babo_M00002  Glycolysis, core module involving three-carbon compounds
babo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK55_2954 (gpm1)
  09102 Energy metabolism
   00680 Methane metabolism
    DK55_2954 (gpm1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DK55_2954 (gpm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:babo04131]
    DK55_2954 (gpm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babo04147]
    DK55_2954 (gpm1)
Enzymes [BR:babo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DK55_2954 (gpm1)
Membrane trafficking [BR:babo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DK55_2954 (gpm1)
Exosome [BR:babo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DK55_2954 (gpm1)
  Exosomal proteins of melanoma cells
   DK55_2954 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIJ90797
Position
2:895094..895714
Genome map
AA seq 206 aa AA seqDB search
MSRTLVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALS
RAQVTCQHILDELGQPGLETIRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDV
PPPGGESLKDTGARVWPYYLHTIQPHVLREETVLVAAHGNSLRALIMALDGLTPEQILKQ
ELNTGVPIIYRLNADSTVASKEILSA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaccctcgtcctggtccgccatggccaaagcgaatggaacctcaagaacctc
tttaccggctggcgtgatccgggcctcaccgagcagggccatgcggaagccaaggccgca
ggccaacgcctcaaggcagccggcctgaagttcgacattgcctacacctccgccctttcc
cgcgcgcaagttacctgccagcacattctcgacgagcttggccagccgggccttgaaacc
atccgcgaccaggccctgaacgagcgcgactatggcgatctctccggtctcaacaaggat
gacgcccgcgcaaagtggggtgaggaacaggttcacatctggcgccgttcctatgacgtc
ccgcctccgggcggcgaaagcctgaaggacaccggcgcgcgcgtctggccctattacctt
cacaccatccagccacatgtgctgcgcgaggagaccgttctggtcgccgcccatggcaat
tcgctgcgcgcactcatcatggcgctcgacggcctgacaccagaacagattctcaagcag
gaactcaacaccggcgttccgatcatctaccggctcaatgccgattcgacggtcgcctcg
aaggaaatcctcagcgcctga

DBGET integrated database retrieval system