KEGG   Brucella abortus bv. 6 870: DO74_162Help
Entry
DO74_162          CDS       T03392                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00071  Fatty acid degradation
babr00072  Synthesis and degradation of ketone bodies
babr00280  Valine, leucine and isoleucine degradation
babr00310  Lysine degradation
babr00362  Benzoate degradation
babr00380  Tryptophan metabolism
babr00620  Pyruvate metabolism
babr00630  Glyoxylate and dicarboxylate metabolism
babr00640  Propanoate metabolism
babr00650  Butanoate metabolism
babr00900  Terpenoid backbone biosynthesis
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01120  Microbial metabolism in diverse environments
babr01130  Biosynthesis of antibiotics
babr01200  Carbon metabolism
babr01212  Fatty acid metabolism
babr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DO74_162 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    DO74_162 (phbA)
   00640 Propanoate metabolism
    DO74_162 (phbA)
   00650 Butanoate metabolism
    DO74_162 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DO74_162 (phbA)
   00072 Synthesis and degradation of ketone bodies
    DO74_162 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DO74_162 (phbA)
   00310 Lysine degradation
    DO74_162 (phbA)
   00380 Tryptophan metabolism
    DO74_162 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DO74_162 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DO74_162 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DO74_162 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babr04147]
    DO74_162 (phbA)
Enzymes [BR:babr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DO74_162 (phbA)
Exosome [BR:babr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DO74_162 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ63580
Position
1:172989..174173
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system