KEGG   Brucella abortus bv. 6 870: DO74_2112Help
Entry
DO74_2112         CDS       T03392                                 

Gene name
guaA
Definition
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00230  Purine metabolism
babr01100  Metabolic pathways
Module
babr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DO74_2112 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:babr01002]
    DO74_2112 (guaA)
Enzymes [BR:babr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     DO74_2112 (guaA)
Peptidases [BR:babr01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   DO74_2112 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase NAD_synthase Peptidase_C26 tRNA_Me_trans ATP_bind_3 QueC ThiI Asn_synthase PAPS_reduct Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: AIJ65430
Position
2:complement(21803..23365)
Genome map
AA seq 520 aa AA seqDB search
MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP
HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP
LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV
HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL
LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE
KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP
ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR
EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF
YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacggcatatcctgacacaatccttatcatcgactttggcagccaggtcacg
cagcttattgcgcggcgtgtgcgcgaggccaatgtctattgcgaaatcgttcccttccag
tctgcggatgaggcgttcaagcggctgcagccgaagggcgtgatcctttccggcagcccg
cattcaacgaccgatatcggttcgccgcgtgcgccgcaggctatttttgatgcgggtatt
ccggttctcggcatttgttatggcgagcagaccatgtgcgcccagcttggcggcaacgtg
gaaagcggccatgatcgtgagttcggccgtgcttttctcgatgtgcaggaagacagtccg
ctctttgccggcatatgggccaagggcacccgccatcaggtctggatgagccatggcgac
cgtgtgacctcgctgccggatggcttcaccatcatcggcacgtcgccgaatgcgccctac
gcggttattgcggatgagaagcgcaaatattacggcgtgcagttccatccggaagttgtg
cacacgccggacggtgcaaagctgttgcagaatttcgttcatcgcattgtcggggtgaag
ccaggctggacgatgggggcctatcgcgaacaggctgtcgaggcgatccgcaaacaggtc
ggcagcggcaaggttatctgcgcgctttcaggcggcgtggattcttccgtggcggcactt
ctggctcatgaagctgtcggcgatcaactgacatgcattctcgttgatcacggcctgatg
cgcaaagacgaagcgcaacaggtcgtggaaatgttccgcgagcattacaatctgccgctg
atcctggtggatgcttccgaccgcttcatcggcgcgcttgagggcgaaagtgacccggaa
aagaagcgcaagaccatcggtcgcctgtttatcgaagtgttcgaggaagaagcaaggaaa
cttggcggcgcggatttcctcgtgcagggtacgctttatcctgacgtgatcgaaagtgtt
tcctttaccggcggcccttcggtcacgatcaagtcgcaccataatgtcggcggtttgccg
gagcgcatgaagatgcagcttgtggagccgctgcgcgagcttttcaaggatgaggttcgt
ctgctcggcaaggaactcggtctgccggacagcttcatcgggcgtcatccgttccccggt
ccgggtcttgcgatccgttgtcccggcggcgtcacgcgcgagaaactggaaatcctgcgc
gaagcggacgcaatctatctggatgaaatccgcaaggctggcctctatgatgcgatctgg
caggctttcgcggttctgcttccggtgcagaccgtgggcgtgatgggggatggccgcact
tacgaattcgtttgcgccttgcgcgcggtgacttcggtggacggcatgacggcggatttc
taccactacgacatgaatttcctcggcaatgcggccacccgcatcatcaacgaagtccgc
ggcatcaaccgcgttgtctatgatgtgacctccaagccgcccggcacgattgagtgggaa
taa

DBGET integrated database retrieval system