KEGG   Brucella abortus bv. 6 870: DO74_2738Help
Entry
DO74_2738         CDS       T03392                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00010  Glycolysis / Gluconeogenesis
babr00053  Ascorbate and aldarate metabolism
babr00071  Fatty acid degradation
babr00280  Valine, leucine and isoleucine degradation
babr00310  Lysine degradation
babr00330  Arginine and proline metabolism
babr00340  Histidine metabolism
babr00380  Tryptophan metabolism
babr00410  beta-Alanine metabolism
babr00561  Glycerolipid metabolism
babr00620  Pyruvate metabolism
babr00625  Chloroalkane and chloroalkene degradation
babr00903  Limonene and pinene degradation
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DO74_2738
   00053 Ascorbate and aldarate metabolism
    DO74_2738
   00620 Pyruvate metabolism
    DO74_2738
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DO74_2738
   00561 Glycerolipid metabolism
    DO74_2738
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DO74_2738
   00310 Lysine degradation
    DO74_2738
   00330 Arginine and proline metabolism
    DO74_2738
   00340 Histidine metabolism
    DO74_2738
   00380 Tryptophan metabolism
    DO74_2738
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DO74_2738
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DO74_2738
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DO74_2738
Enzymes [BR:babr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DO74_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ65857
Position
2:complement(682135..683637)
Genome map
AA seq 500 aa AA seqDB search
MNTAVRKIDVKKEAADLLSKLGVDASAYTGGDLTGFSPVSGEEIASIKTHSKEDAEKIIA
KADEAFRAWRTVPAPKRGELIRLLGEELRASKEDIGRLVSLEAGKIPSEGLGEVQEMIDI
CDFAVGLSRQLYGLTIATERAGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALAIVCGN
AVVWKPSEKTLLTALACDAIFKRALKRFGDAPEGISQLLLGDREIGEVLVDSPKVPVVSA
TGSTRMGREVGPRLAKRFARAILELGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTT
LRRLFVHESVYDALVPRLQKAYASVSVGSPLETSALVGPLIDKQAFDNMQKALKEAAAHG
GKVQGGERVDTGYENAYYVRPAIVEMPRQEGPVLEETFAPILYVMKYSDFDDVLASHNAV
GAGLSSSIFTLNLQEAERFLSAEGSDCGIANVNIGTSGAEIGGGRESGSDAWKAYMRRAT
NTINYSKALPLAQGVSFDID
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgctgttagaaaaatcgacgtgaagaaggaagccgccgatctgctttccaaa
ctcggcgtcgacgcatccgcctataccggcggcgatcttaccggtttcagccccgtttcc
ggtgaagagatcgcttcgatcaagacccacagcaaggaagacgccgaaaagatcatcgcc
aaggccgatgaagccttccgcgcatggcgcaccgttcccgcgccaaagcgcggagagctg
atccgcctgctcggcgaagaactgcgcgcctccaaggaagacatcggccgtctcgtctcg
ctcgaagcaggcaagatcccgtcggaaggtctgggcgaagtgcaggaaatgatcgatatc
tgcgatttcgcagtcggtctgtcgcgccagctttacggcctcaccatcgccaccgaacgc
gccggccatcgcatgatggaaacctggcatccgctgggcgtcgtcggcgttatttccgcc
ttcaacttccccgtcgctgtctggtcatggaatgcggcgctcgccatcgtttgcggcaac
gcggttgtgtggaagccgtctgaaaagaccttgctcaccgcgcttgcctgcgatgcgatt
ttcaagcgcgcgctcaagcgtttcggcgatgcgccggaaggcatttcgcagctcctgctc
ggcgaccgtgaaatcggtgaagtcctcgttgacagcccgaaagttcccgttgtttcggca
accggctcgacccgcatgggccgcgaagtcggcccgcgcctggccaagcgttttgcgcgc
gcgatcctcgaactcggcggcaacaatgccggtatcgtctgcccgtcggccgatctggac
atggcactgcgcgcaatcgcttttggcgccatgggcaccgccggtcagcgctgcaccaca
ttgcgccgtcttttcgtgcacgaaagcgtttatgacgcactcgttccgcgtctccagaag
gcctatgccagcgtttcggtcggctcgccgcttgaaaccagcgctctggtcggcccgctg
atcgacaaacaagccttcgacaatatgcagaaggcgctgaaagaagcagccgcccatggc
ggcaaggtgcagggcggcgagcgcgtcgataccggatatgaaaacgcctattatgtgcgc
ccggctattgtcgaaatgccacgtcaggaaggcccggttctcgaagaaaccttcgcaccg
atcctttatgtgatgaaatattccgacttcgacgatgtgctggcgagccacaatgcggtc
ggcgcgggcctgtcatcctcgatcttcacgctgaatttgcaggaagcggaacgtttcctc
tccgcagaaggttcggattgcggcatcgccaatgtcaatatcggcacgtcgggcgctgaa
atcggcggcggccgtgaatccggttcggatgcatggaaggcctatatgcgccgtgcaacc
aacaccatcaactactcgaaggccctgccgcttgcacagggtgtttccttcgatatcgac
tga

DBGET integrated database retrieval system