KEGG   Brucella abortus bv. 6 870: DO74_2845Help
Entry
DO74_2845         CDS       T03392                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00071  Fatty acid degradation
babr00072  Synthesis and degradation of ketone bodies
babr00280  Valine, leucine and isoleucine degradation
babr00310  Lysine degradation
babr00362  Benzoate degradation
babr00380  Tryptophan metabolism
babr00620  Pyruvate metabolism
babr00630  Glyoxylate and dicarboxylate metabolism
babr00640  Propanoate metabolism
babr00650  Butanoate metabolism
babr00900  Terpenoid backbone biosynthesis
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01120  Microbial metabolism in diverse environments
babr01130  Biosynthesis of antibiotics
babr01200  Carbon metabolism
babr01212  Fatty acid metabolism
babr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DO74_2845
   00630 Glyoxylate and dicarboxylate metabolism
    DO74_2845
   00640 Propanoate metabolism
    DO74_2845
   00650 Butanoate metabolism
    DO74_2845
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DO74_2845
   00072 Synthesis and degradation of ketone bodies
    DO74_2845
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DO74_2845
   00310 Lysine degradation
    DO74_2845
   00380 Tryptophan metabolism
    DO74_2845
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DO74_2845
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DO74_2845
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DO74_2845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babr04147]
    DO74_2845
Enzymes [BR:babr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DO74_2845
Exosome [BR:babr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DO74_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIJ65772
Position
2:790205..791413
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLSPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
agcccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system