KEGG   Brucella abortus BER: DK51_1122Help
Entry
DK51_1122         CDS       T03685                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
babs  Brucella abortus BER
Brite
KEGG Orthology (KO) [BR:babs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DK51_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 PUMA
Motif
Other DBs
NCBI-ProteinID: AIJ54675
UniProt: A0A4Q5MJK4
Position
1:1134142..1134534
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETVQLCSRYWQITDANGH
VQEVRGSGVVGKQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMKGEDGAQFEIEIPAFSL
DVPEQRRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgcggtaacacgcgggatcgaagttacggtcgagcccttttatctggaagtc
caatccgagccggaagaaaaccgttatgtatggggttatcgcgtcacgatcgtgaacaac
tcatccgaaacggtgcagctttgctcgcgctactggcagatcaccgacgccaacggccat
gtgcaagaagtgcgcggttcaggcgtggtcggcaagcagcctgttctcgatccgggcgat
tcataccagtattcttccggttgcccgctcacaacctcgtcaggcgtgatggtcgggcgc
taccagatgaagggcgaagacggcgcacaattcgagatcgagattcccgccttttcactc
gacgtacccgaacagcgccgcacgctgaactga

DBGET integrated database retrieval system