KEGG   Brucella abortus BER: DK51_1494Help
Entry
DK51_1494         CDS       T03685                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
babs  Brucella abortus BER
Pathway
babs00270  Cysteine and methionine metabolism
babs00480  Glutathione metabolism
babs01100  Metabolic pathways
Module
babs_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:babs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DK51_1494 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK51_1494 (gshB)
Enzymes [BR:babs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     DK51_1494 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AIJ54534
UniProt: A0A4Q2THT3
Position
1:complement(1522861..1523799)
Genome map
AA seq 312 aa AA seqDB search
MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV
RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR
NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL
TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR
PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI
AALFWNAVEARR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaagtcgcggtccagatggaccatatcagcacggtgaacatcacgggcgat
accactttcgctctctcgcttgaggcgcaaaagcgcggccacgagcttttccattatacg
cccgaccggctttccatgcgcgatggcgtggtttccgcccgcgtggaaaagatggaagtg
cgcgatgtgaagggcgatcattacacgctgggcgagcctgtccgccgcgacctcacggaa
atggatgtgatcctgctgcgccaggatccgccttttgacatgaattacatcaccacgacg
catcttctggaacgcatccatccaaagacgctggtggtcaacgatccggcctgggtgcgc
aacagcccggaaaagatttttgtcaccgaatttcccgacctgatgccggaaacgctcatc
accaaggatccgcaggaggtgatggatttccgccgtgaattcggcgacatcatcctgaag
ccgctttacggcaatggcggcgcgggcgtcttccatctggcggatggcgaccgcaacctt
acctcgcttctggaaatgttcggccagcttttcagggagccgttcatcgcgcagcgctat
ctgaaagatgtgcgggcgggcgacaagcgtatcatcctcatcgatggcgagccggtgggc
gcgctgaaccgcgtgccgtccgaaaccgacgcacgctccaacatgcatgtgggcggacgc
cccgaacagagcaagttgaccccgcgtgagcgtgaaatctgcgcgcgcattggcccctcg
ctgaaagagcgcggcttcatcctcgtcggcatcgacgtgattggcgactacatgacggaa
atcaacgtgacgtcgccgacaggtatccgtgaaatcgaacgttttgacggcaccaatatt
gccgccctgttctggaatgcggtggaagccagacgataa

DBGET integrated database retrieval system