KEGG   Brucella abortus BER: DK51_1575Help
Entry
DK51_1575         CDS       T03685                                 

Gene name
afr
Definition
(GenBank) 1,5-anhydro-D-fructose reductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
babs  Brucella abortus BER
Brite
KEGG Orthology (KO) [BR:babs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK51_1575 (afr)
Enzymes [BR:babs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     DK51_1575 (afr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIJ54878
Position
1:1605403..1606404
Genome map
AA seq 333 aa AA seqDB search
MAKWGLIGASTIAKEWVIGAIRATGGEVVSVYSTNAARGKTYADENGIARSVTSLDALLA
DPEIDAVYISTTNELHRDKAIAAAQAGKHILCEKPLALTIGDAHEMLKAARAAGVVAGTN
HHLRNAASHRAMRDAVAEGRIGKVLGARVFHAVYLPPHLQGWRIERPDAGGGVVLDITVH
DADTLRFVLGENPVEAVAFSQQGGLSGEGLEDGVMGVLRFPSGAIAQFHDAFTAKYAETG
FGVHGSEGSLIARNVMTQKPVGTVILGDKDGEHELPLDHKNLYETALQAFHDAIAGRGQP
SATLEDGIWSLATGLAVLEAAKTGKATAVHSGL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtggggccttataggcgcaagcaccattgcaaaggaatgggtgatcggcgcc
attcgcgcgacgggtggcgaggtcgtttccgtctacagcaccaatgccgcgcgcggtaaa
acctatgcagacgagaacggcatcgcccgttcggtgacgagcctcgatgcgctgctggcc
gacccggaaatagacgcggtttatatctccaccaccaatgaactgcatcgcgataaggcc
attgccgcggcacaagcgggcaagcatatcctgtgcgaaaagccgctggcgctgacgatt
ggtgacgctcatgaaatgctgaaagcggcgcgcgcagcgggcgtggtggcaggcaccaat
catcatttgcgcaatgcggcaagccaccgcgccatgcgcgatgccgtagcagaaggccgg
atcggcaaggtgctgggcgcgcgggttttccatgcggtttatttgccgccacacttacag
ggctggcgcattgagcggcccgatgcgggcggcggtgtcgtcctcgatatcactgtgcat
gatgccgatacgctgcgttttgtgctgggggaaaatccggtcgaggcggtcgctttcagt
caacagggcggcttaagtggagaagggctggaagatggcgtgatgggcgttttgcgtttt
ccatccggggcgattgcccagtttcacgatgctttcaccgccaaatatgccgaaaccggt
ttcggggtgcatggcagcgaaggttcgctcattgcgcgcaatgtgatgacgcaaaagccg
gtcgggaccgtcatcctgggggacaaggacggcgaacacgaattgccgctcgaccacaaa
aatctctacgaaaccgccttgcaggcttttcacgatgccattgccggaagaggccagcca
tcggccacattggaggatggcatctggtcgctcgccaccgggctggccgtgcttgaggcc
gcaaaaaccggcaaagccaccgccgttcattcaggactttaa

DBGET integrated database retrieval system