KEGG   Brucella abortus BER: DK51_248Help
Entry
DK51_248          CDS       T03685                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
babs  Brucella abortus BER
Pathway
babs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:babs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DK51_248 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:babs03011]
    DK51_248 (rplV)
Ribosome [BR:babs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DK51_248 (rplV)
  Bacteria
    DK51_248 (rplV)
  Archaea
    DK51_248 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570 TniB
Motif
Other DBs
NCBI-ProteinID: AIJ53929
UniProt: Q075U6
Position
1:255357..255746
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVK
KTLESAIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRDRGRASRIEKPFSHLTIVVR
EVAEKGKAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggccaaggctccccgccagcttaaggataacgaggcgaaagccgtcgcccgt
acgctccgcgtcagcccgcagaagcttaaccttgtcgcgagcatgattcgcggcaagaaa
gtgaatgcggcacttgccgatctgacgttctcgcgcaagcggatcgccggtaccgtcaag
aagacgcttgagtcggcgattgcaaacgctgaaaacaatcacgatctcgacgtcgatgcc
ctgatcgtcgccgaagcctatgtgggcaagtcgatcgtcatgaagcgcttccacgtccgt
gaccgtggccgcgcgagccgtatcgagaagccgttttcgcatctcaccattgttgtccgc
gaagtcgcggaaaaagggaaggccgcataa

DBGET integrated database retrieval system