KEGG   Brucella abortus 63 75: DK49_2809Help
Entry
DK49_2809         CDS       T03461                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babt  Brucella abortus 63 75
Pathway
babt00071  Fatty acid degradation
babt00072  Synthesis and degradation of ketone bodies
babt00280  Valine, leucine and isoleucine degradation
babt00310  Lysine degradation
babt00362  Benzoate degradation
babt00380  Tryptophan metabolism
babt00620  Pyruvate metabolism
babt00630  Glyoxylate and dicarboxylate metabolism
babt00640  Propanoate metabolism
babt00650  Butanoate metabolism
babt00900  Terpenoid backbone biosynthesis
babt01100  Metabolic pathways
babt01110  Biosynthesis of secondary metabolites
babt01120  Microbial metabolism in diverse environments
babt01130  Biosynthesis of antibiotics
babt01200  Carbon metabolism
babt01212  Fatty acid metabolism
babt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK49_2809
   00630 Glyoxylate and dicarboxylate metabolism
    DK49_2809
   00640 Propanoate metabolism
    DK49_2809
   00650 Butanoate metabolism
    DK49_2809
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK49_2809
   00072 Synthesis and degradation of ketone bodies
    DK49_2809
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK49_2809
   00310 Lysine degradation
    DK49_2809
   00380 Tryptophan metabolism
    DK49_2809
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK49_2809
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK49_2809
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK49_2809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babt04147]
    DK49_2809
Enzymes [BR:babt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK49_2809
Exosome [BR:babt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK49_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIJ79388
Position
2:complement(762299..763507)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLSPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
agcccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system