KEGG   Brucella abortus 63 75: DK49_286Help
Entry
DK49_286          CDS       T03461                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
babt  Brucella abortus 63 75
Pathway
babt00361  Chlorocyclohexane and chlorobenzene degradation
babt00625  Chloroalkane and chloroalkene degradation
babt01100  Metabolic pathways
babt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:babt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK49_286
   00361 Chlorocyclohexane and chlorobenzene degradation
    DK49_286
Enzymes [BR:babt01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DK49_286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AIJ81341
UniProt: A0A4V1ZFL6
Position
1:complement(278025..278642)
Genome map
AA seq 205 aa AA seqDB search
MNSSPVKHVVFDIGKVLIHYDPELAFLDIIPDAGERRWFLENICTSAWNIEQDRGRSWQE
AEALLLESHPQHHDHIRAFRRNWSRMVPHAYDDSVEILRGLIAAGHDVTMLTNFASDTFR
EAQARFPFLTESRGVTVSGDIRLIKPDRAIYDHHVASFGLDPAATLFIDDTMHNVEGAKQ
AGWQAVHFTSAAKLADDLRARQLSF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagtagcccggtcaaacatgtcgttttcgatatcggcaaggtgctcattcactat
gatccggaacttgcctttctggatatcattcctgatgctggcgaacggcgctggtttctg
gaaaatatctgcaccagcgcgtggaacatcgaacaggatcgcgggcgaagctggcaggaa
gccgaagccctgcttctggaaagccacccgcaacatcacgaccatatccgcgctttccgc
cggaactggagccgcatggtgccccatgcctatgacgacagcgttgaaatcctgcgcggg
ctcattgcggctggccacgacgtgaccatgctcaccaatttcgcatccgatacattccgg
gaagcacaggcccgctttcccttcctgaccgaaagccgtggcgtgacggtttcaggcgat
atccgcctcatcaaacccgaccgggcgatctacgatcatcacgtcgcctcgttcggcctc
gatccggcagcaacgctcttcatcgatgacacgatgcacaatgtggaaggtgcgaagcaa
gcgggctggcaggcggtgcattttaccagcgcagccaaactggccgacgatttgcgggcg
cgacagctttctttctga

DBGET integrated database retrieval system