KEGG   Brucella abortus 63 75: DK49_2877Help
Entry
DK49_2877         CDS       T03461                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
babt  Brucella abortus 63 75
Pathway
babt00010  Glycolysis / Gluconeogenesis
babt00030  Pentose phosphate pathway
babt00051  Fructose and mannose metabolism
babt00680  Methane metabolism
babt01100  Metabolic pathways
babt01110  Biosynthesis of secondary metabolites
babt01120  Microbial metabolism in diverse environments
babt01130  Biosynthesis of antibiotics
babt01200  Carbon metabolism
babt01230  Biosynthesis of amino acids
Module
babt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
babt_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:babt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK49_2877 (fba)
   00030 Pentose phosphate pathway
    DK49_2877 (fba)
   00051 Fructose and mannose metabolism
    DK49_2877 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    DK49_2877 (fba)
Enzymes [BR:babt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DK49_2877 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AIJ78561
UniProt: A0A4Q5MQA4
Position
2:complement(835115..836179)
Genome map
AA seq 354 aa AA seqDB search
MARITLRQLLDHAAEKGYGVPAFNINNMEQALAIMEAANAVDAPVILQASRGARSYANDI
MLRHMMDAVAEIYPHIPVCVHLDHGNEAATCMSAIQAGFTSVMMDGSLKADGKTPADWDY
NVSVTRQVSEMSHLGGISVEGELGVLGSLETGMGDVEDGHGAEGKLSHDQLLTDPDEAVK
FVRETKVDALAIAMGTSHGAYKFSRKPDGSVLAMHVIEEIHRKLPNTHLVMHGSSSVPEE
LQEIINKYGGQMKPTWGVPVEEIQRGIKHGVRKINIDTDNRMAMTGQIRRILQEEPSEFD
PRKYLKPAMAAMTKLCKERFEQFGTAGHAASIRPIPLSEMAKRYRDGSLDPKFS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcattacgctgcggcaattgctcgatcacgccgctgaaaagggttacggcgtt
ccggcattcaacatcaacaacatggaacaggcactggccatcatggaagcggcaaatgcc
gtggatgcgccggttatcctgcaggcttcgcgcggcgcgcgttcctatgccaatgacatc
atgctccgtcacatgatggatgccgtggcggaaatctatccgcatattccggtctgcgtg
catctcgaccatggcaacgaagccgccacctgcatgagcgccatccaggcgggcttcacc
tccgtcatgatggacgggtcgctgaaggccgacggcaagacgcccgccgactgggactat
aacgtctccgtcacgcgccaggtcagcgagatgtcgcatctgggcggcatttcggtggaa
ggtgagctcggcgttctgggttcgcttgaaaccggcatgggcgatgtcgaagacggccat
ggcgcggaaggcaagctttcgcacgaccagcttctgaccgacccggatgaagctgtgaag
ttcgtgcgcgaaaccaaggtcgatgcgctggcgatcgccatgggcacctcgcacggcgct
tataagttcagccgcaagccggatggttccgtgctcgccatgcatgtgatcgaggaaatc
catcgcaagctgccgaacacccaccttgtcatgcatggttcgtcgtcggtgccggaagaa
ttgcaggaaatcatcaacaagtatggcggccagatgaagccaacctggggtgtgccggtt
gaggaaatccagcgcggcatcaagcatggcgtgcgcaagatcaacatcgatacggataac
cgcatggcgatgaccggccagatccgccgcatcttgcaggaagaaccgagcgaattcgat
ccgcgcaagtacctcaagcccgccatggctgcgatgaccaagctgtgcaaggagcgtttc
gagcagttcggcaccgccggtcacgcggcttccatccgcccgatcccgctttccgaaatg
gcaaagcgttatcgcgacggttcgctggacccgaagttcagctaa

DBGET integrated database retrieval system