KEGG   Brucella abortus 63 75: DK49_2904Help
Entry
DK49_2904         CDS       T03461                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
babt  Brucella abortus 63 75
Pathway
babt00220  Arginine biosynthesis
babt00330  Arginine and proline metabolism
babt01100  Metabolic pathways
babt01110  Biosynthesis of secondary metabolites
babt01130  Biosynthesis of antibiotics
babt01230  Biosynthesis of amino acids
Module
babt_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:babt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    DK49_2904 (rocF)
   00330 Arginine and proline metabolism
    DK49_2904 (rocF)
Enzymes [BR:babt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DK49_2904 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AIJ78848
Position
2:complement(860031..860951)
Genome map
AA seq 306 aa AA seqDB search
MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTDLGNLAPAAQRPLQHPN
HAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGTVPGIARRAAEKGRKQFVL
WLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKLAAPIDPHNVCMLGIRSVDPA
EREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFLDERGRTAAVMVDLMASLLGRSVMD
RPTISY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtaagattctggggctgcccgttcaggaaggcactggccgcaagggctgtaat
atggggcctgattcctatcgtgcggccgggattgccgatgccataagggaacttgggcac
gagtgcacagatttgggcaatctggcgcctgccgcccagcgcccgctacagcatccgaac
catgcaatcaaggcgcttccatatgccgttgcctggatcgaagcgatcagcgaagcggcc
tatcgcgaaagtgcggaagggttcccgatctttcttggtggcgatcaccttctggcagcg
ggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgcaagcaattcgtgctc
tggctcgatgcgcatacggatttccatacgctggaaaccacgaccagcggcaatcttcat
ggtacgcccgttgcttattataccggtcagaagggctttgagggctatttccccaagctt
gcagcgccgatcgatccgcataatgtctgcatgttgggcattcgcagcgtcgatccggct
gagcgggaagcggtcaagaaaacagaagttatcgtctatgacatgcggctgatcgacgag
catggtgttgccgccctgctgcgccggtttctggagcgcgtgaaggcggaagacgggctg
ttgcatgtgagccttgatgtcgattttctcgatccctccatcgcgccggccgtgggtacg
acggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatggagatgctgcacgac
agcgggctggtgacgagcctcgatctcgttgaactcaatccctttcttgatgagcgcggc
cgcacggccgccgtcatggtggacctgatggcgagccttctgggccgcagcgtcatggac
cgcccgaccatcagctattga

DBGET integrated database retrieval system