KEGG   Brucella abortus 63 75: DK49_956Help
Entry
DK49_956          CDS       T03461                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
babt  Brucella abortus 63 75
Pathway
babt00020  Citrate cycle (TCA cycle)
babt00480  Glutathione metabolism
babt01100  Metabolic pathways
babt01110  Biosynthesis of secondary metabolites
babt01120  Microbial metabolism in diverse environments
babt01130  Biosynthesis of antibiotics
babt01200  Carbon metabolism
babt01210  2-Oxocarboxylic acid metabolism
babt01230  Biosynthesis of amino acids
Module
babt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
babt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:babt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK49_956
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK49_956
Enzymes [BR:babt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DK49_956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIJ80562
UniProt: A0A4Q5MNQ3
Position
1:958071..959285
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDIDLKYYDLSVENRDATNDQVTIDA
ANAIKEYGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYRATDFKFPGKGTLTIKFVGEDGQTIEHEVYQAPSAGVAMAM
YNLDESIREFARASFNYGLQRGYPVYLSTKNTILKAYDGRFKDIFQEVFDAEFKSKFEEK
KIWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAHRAKLDNNADLKKFAETLEKV
CVDTVESGFMTKDLALLIGPDQPWLSTTGFLDKIDENLQKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcaaggttgcaaacccggtcgtcgagctcgacggcgacgagatgacccgc
attatctggcagttcatcaaggacaagcttatccatccctatctcgacatcgacctgaaa
tactacgatctttcggtcgagaaccgcgatgcgaccaatgatcaggtcacgatcgatgca
gccaatgccatcaaggaatatggcgtgggcgtaaaatgcgcgaccatcacgcccgacgaa
gcgcgcgtggaagaattcaagctgaagaaaatgtggaagtcgcccaacggcaccatccgc
aatatcctcggcggcgtgatcttccgcgagccgatcatctgcaagaacgtgccgcgcctc
gtgccgggctggacccagccgatcatcgtcggccgccatgctttcggcgaccagtaccgc
gcgactgacttcaagttccccggcaagggcacactgacgattaagttcgtcggtgaagat
ggccagaccatcgaacatgaagtctatcaggccccttcggctggcgtggccatggccatg
tataatctggacgaatcgatccgcgaattcgcacgcgcttccttcaattacggcttgcag
cgcggctatccggtctatctctccacgaagaacaccatcctcaaggcctatgatggccgc
ttcaaggacatcttccaggaagtcttcgacgccgaattcaagtcgaagtttgaagaaaag
aagatctggtacgaacaccgcctcatcgacgacatggtcgcctcggcgctcaagtggtcg
ggcggctatgtctgggcctgtaagaactatgatggcgacgtgcagtcggatatcgtcgcg
cagggcttcggctcgctcggcctgatgacctcggttctgatgacgccggatggcaagacg
gtggaagcggaagccgcccacggcaccgtaacccgccactatcgccagcatcagaagggc
gaggaaacctcgaccaactccatcgcttcgatcttcgcatggacccgcggtctggcgcat
cgcgccaagctcgacaacaatgccgatctgaagaagttcgccgaaacgctggaaaaggtc
tgcgtggacaccgttgaaagcggcttcatgaccaaggatctggcgctcctcatcggcccg
gatcagccttggctctcgaccaccggcttcctcgacaagatcgacgaaaatcttcagaaa
gccatggctgcctga

DBGET integrated database retrieval system