KEGG   Brucella abortus 63 75: DK49_984Help
Entry
DK49_984          CDS       T03461                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
babt  Brucella abortus 63 75
Pathway
babt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:babt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DK49_984 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:babt03011]
    DK49_984 (rplV)
Ribosome [BR:babt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DK49_984 (rplV)
  Bacteria
    DK49_984 (rplV)
  Archaea
    DK49_984 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570 TniB
Motif
Other DBs
NCBI-ProteinID: AIJ79409
UniProt: Q075U6
Position
1:complement(981224..981613)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVK
KTLESAIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRDRGRASRIEKPFSHLTIVVR
EVAEKGKAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggccaaggctccccgccagcttaaggataacgaggcgaaagccgtcgcccgt
acgctccgcgtcagcccgcagaagcttaaccttgtcgcgagcatgattcgcggcaagaaa
gtgaatgcggcacttgccgatctgacgttctcgcgcaagcggatcgccggtaccgtcaag
aagacgcttgagtcggcgattgcaaacgctgaaaacaatcacgatctcgacgtcgatgcc
ctgatcgtcgccgaagcctatgtgggcaagtcgatcgtcatgaagcgcttccacgtccgt
gaccgtggccgcgcgagccgtatcgagaagccgttttcgcatctcaccattgttgtccgc
gaagtcgcggaaaaagggaaggccgcataa

DBGET integrated database retrieval system