KEGG   Brucella abortus bv. 9 C68: DK53_1479Help
Entry
DK53_1479         CDS       T03474                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK53_1479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:babu02022]
    DK53_1479
Two-component system [BR:babu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DK53_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIJ60782
Position
1:1504209..1504916
Genome map
AA seq 235 aa AA seqDB search
MAAEEEKTLSDDAPHFLVVDDDTRIRSLLSQYLTNSGFRVTMAGSAAEARRKLEGIDFDL
LILDVMMPGETGVSLTRSLREQKNVPILMLTALSETDSRIDGLAAGADDYLPKPFDPREL
TLRINNILRRGAPPAQPKIEQIVFGPYTFFIPRRELKKGTETIKLTDREQDIMAIFAERA
GETIPRHELTGQDGDVGERTIDVQINRLRRKIEQDPANPVWLQTVRGIGYKLSIE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaagaagaaaagacgctatcggacgacgcaccgcactttctcgtcgtggac
gacgatacgcgcatccgcagccttctctcacaatatctgaccaatagcgggtttcgcgtc
acgatggctggcagtgcagccgaagcgcgccgcaagctggaaggcatcgacttcgacctt
ctgattctcgacgtgatgatgccgggagaaaccggcgtttcgctgacgcgctccttgcgc
gaacagaagaacgtgccgattctcatgctgacagccctgtcggaaaccgacagccgcatc
gacggcctggctgccggagcagacgactatctgcccaaaccctttgatccgcgcgaactg
acactgcgtatcaacaatatcctgcgccgtggcgcaccgcccgcgcagccgaagatcgaa
cagatcgtgttcggcccttatacttttttcattccgcgtcgcgaattgaagaagggaacc
gagacgatcaagctcaccgaccgcgagcaggatatcatggcgatctttgccgagcgggcg
ggcgaaaccatcccccgccatgaactgaccgggcaggacggcgatgtgggtgaacgcacg
atcgatgtgcagatcaaccgtctgcgccgaaagatcgagcaggatcccgcaaacccggtc
tggctccagaccgtgcgcggcatcggctacaaactcagcatcgaatag

DBGET integrated database retrieval system