KEGG   Brucella abortus bv. 9 C68: DK53_1709Help
Entry
DK53_1709         CDS       T03474                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00071  Fatty acid degradation
babu00072  Synthesis and degradation of ketone bodies
babu00280  Valine, leucine and isoleucine degradation
babu00310  Lysine degradation
babu00362  Benzoate degradation
babu00380  Tryptophan metabolism
babu00620  Pyruvate metabolism
babu00630  Glyoxylate and dicarboxylate metabolism
babu00640  Propanoate metabolism
babu00650  Butanoate metabolism
babu00900  Terpenoid backbone biosynthesis
babu01100  Metabolic pathways
babu01110  Biosynthesis of secondary metabolites
babu01120  Microbial metabolism in diverse environments
babu01130  Biosynthesis of antibiotics
babu01200  Carbon metabolism
babu01212  Fatty acid metabolism
babu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK53_1709 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    DK53_1709 (phbA)
   00640 Propanoate metabolism
    DK53_1709 (phbA)
   00650 Butanoate metabolism
    DK53_1709 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK53_1709 (phbA)
   00072 Synthesis and degradation of ketone bodies
    DK53_1709 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK53_1709 (phbA)
   00310 Lysine degradation
    DK53_1709 (phbA)
   00380 Tryptophan metabolism
    DK53_1709 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK53_1709 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK53_1709 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK53_1709 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babu04147]
    DK53_1709 (phbA)
Enzymes [BR:babu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK53_1709 (phbA)
Exosome [BR:babu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK53_1709 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ60949
Position
1:complement(1732962..1734146)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system