KEGG   Brucella abortus bv. 9 C68: DK53_1850Help
Entry
DK53_1850         CDS       T03474                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00020  Citrate cycle (TCA cycle)
babu00310  Lysine degradation
babu00380  Tryptophan metabolism
babu01100  Metabolic pathways
babu01110  Biosynthesis of secondary metabolites
babu01120  Microbial metabolism in diverse environments
babu01130  Biosynthesis of antibiotics
babu01200  Carbon metabolism
Module
babu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
babu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK53_1850 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    DK53_1850 (sucB)
   00380 Tryptophan metabolism
    DK53_1850 (sucB)
Enzymes [BR:babu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DK53_1850 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIJ61437
Position
1:complement(1884184..1885410)
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT
AKEGDTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQPAPA
AAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAARPASSADDASREE
RVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVFEKKHGVKLGFMGF
FTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVVPVIRDADQMSIAEVEK
ELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHKIQERPMV
VGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcccacgcttggggagtccgttaccgaggcaaccatcgga
aagtggttcaagaaggctggtgaagccattgctgtcgatgagccgctggtggaactggaa
accgacaaggtgacggtcgaagtgcccgcaccggctgcgggtgttctggccgaaatcacg
gccaaggaaggcgatacggtcgaagtgggcgcactgctcggccagatttccagtgacggg
gcagcggttgccgccgcaccggcccagaagaaggaggaagccaagcctgcagccgccgct
cctgctgctgcaccggtcgcatcggcttcgtcgggcccggccatgcagccggcgccggct
gctgcgaagcttctggctgaaagcggtctttccgccgatcaggtcgaaggttccggcaag
cgcggccaggtgctcaaaggtgacgttctcgaggccatcacgaaaggcgtttcggcggct
cctgccgctccggttgccgcgcgtccggcctcctcggctgatgacgcatcgcgcgaagag
cgtgtgaagatgacccgtctgcgccagaccattgcgcgccgcctgaaggatgcccagaac
acggctgccatgctcaccaccttcaacgaggtggacatgtcggcagtcatggagctgcgt
aacaagtataaggacgtctttgaaaagaagcatggcgtgaagcttggcttcatgggcttc
ttcaccaaggcagtgacgcatgcgctgaaggaaatcccggctgtcaacgccgagatcgac
ggcacggacatcgtctacaagaacttctgccatgtcggcatggctgtcggcaccgacaag
ggcctcgtcgttccggtcatccgcgatgccgaccagatgtcgattgcggaagtggaaaag
gaactggcacgtctcgccagggctgcgcgtgacggctcgctttccatggccgatatgcag
ggcggcacctttaccatcaccaatggcggtgtttacggttcgctcatgtccacgccgatc
ctcaatgcgccgcagtcgggcattctcggtatgcacaagatccaggaacgcccgatggtc
gtcggtggccagatcgtggtccgcccgatgatgtatctggcgctttcctacgatcaccgc
atcgtggacggcaaggaagccgtgaccttcctcgtgcgtgtgaaggaaagcctggaagat
ccggaacgtctggttctcgatctctag

DBGET integrated database retrieval system